Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G11770-AT5G06450
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Polynucleotidyl transferase, ribonuclease H-like superfamily protein
Function (paralog2):Polynucleotidyl transferase, ribonuclease H-like superfamily protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-0.84914292123081
Log2 mRNA fold difference:-1.5632994189986
Log2 TE fold difference:0.72576110667946
Sequences
Protein sequence

MASFDGQGFMMVDNSWVQTKAIDVESTTDISPYLSKILEDSVWNGNRSIVFDVYWDVKSV
STKSEWRLCSVKFSTKNFCLFLRLPNPFCDNLKDLYRFFASKFVTFVGVQIQEDLALLKE
NHGIVIRSSLEIGKLAAKARGTPIVEFLGTRELAHKILWYDMSRLDSIQSKWDEASSNDR
LEAAAIEGWLIFNVYDQLQQ

MASFDGPKFKMTDGSYVQTKTIDVGSSTDISPYLSLIREDSILNGNRAVIFDVYWDVGFP
ETETKTKTSGWSLSSVKLSTRNLCLFLRLPKPFHDNLKDLYRFFASKFVTFVGVQIEEDL
DLLRENHGLVIRNAINVGKLAAEARGTLVLEFLGTRELAHRVLWSDLGQLDSIEAKWEKA
GPEEQLEAAAIEGWLIVNVWDQLSDE

www.000webhost.com

Other information
Ka divergence:0.275692KaKs divergence:0.176471
GC content 1 (%):43GC content 2 (%):45GC content divergence:0.023
Length 1 (bp):603Length 2 (bp):621Length divergence:0.015
MFE 1 (kcal):-178.45MFE 2 (kcal):-191MFE divergence0.034