Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G11780-AT5G06480
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):MD-2-related lipid recognition domain-containing protein / ML domain-containing protein
Function (paralog2):Immunoglobulin E-set superfamily protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-6.2197242074609
Log2 mRNA fold difference:-6.008128580329
Log2 TE fold difference:-0.22822552711477
Sequences
Protein sequence

MSKFTGFSSLAISYFLLVSTIVAATDVHYCDNNEEYEVKVQGVDITPYPIARGEPATFRI
SANTDTEISSGKLVIEVSYFGWHIHSETHDLCDETSCPVAIGDFLVAHSQVLPGYTPPTE
KRFNLVSIAYYEFHVEGSYSLKMKMLDGRKKELTCIKFSFDIGFGSSVADM

MSRIFAILPLAAVFLLLLVSPIVAIDVHYCEENAEYEVKVKEVDISPNPIAPGEPATFTI
SANTGREISFGKLVIEVSYFGWHVHSETHDLCTETSCPIQTGDFLVAHSQVLPGYTPPGS
YLLKMKMLDAKKKELTCIKFSFDIGLRASVADI

www.000webhost.com

Other information
Ka divergence:-0.115235KaKs divergence:0.103299
GC content 1 (%):42GC content 2 (%):44GC content divergence:0.023
Length 1 (bp):516Length 2 (bp):462Length divergence:-0.055
MFE 1 (kcal):-143.69MFE 2 (kcal):-120.62MFE divergence-0.087