Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G11850-AT5G06560
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein of unknown function, DUF593
Function (paralog2):Protein of unknown function, DUF593

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.3232311007295
Log2 mRNA fold difference:1.3552466983017
Log2 TE fold difference:-0.35028899445711
Sequences
Protein sequence

MESPIKCCDCGCDCCSSSPGSWIRSVKKRRHDELQTEKRFSIPELDDLDMFSNPRVQIEN
ECELLRETVSNQQQTIQDLYHELEQERIASSTAADETVKMIQTLEREKAKIDLELKQLQR
SVDETLNYENQEIEALENMVYQRDQTIQALTFETQAYKHRMMSFGLTEAEADGERSLLSR
NPSMIDFSSEYDCPTQDYPPLKCNINENQDPLEADIYVADDENYPPADSPHGRVHLKTLD
RRLSQMETNPSFTQLNRGRDVSEKGMVGESPRRQRHFRRISPTGSSSSHLGASKELRPDV
FVDSPRSQSYSSKKMEDVSYTENNNAKDDLSEIGDDMSDRVYTIDSVHHSSVAHSGGVAE
QKIEDGASDGNVVFPREHTDLGDPDITKLYMRLQALEADRESMKHALLSMRTEKAQMVLL
KEIAQHLSKEVVPQRRLPLRKASIAGPLTFTPVFKWITSFVSWKRKARRSKYMYGMSGNN
IGLQMLLEKVPRSRKWRCLRSTQV

MDLAIVSSPTRDVVRCCDCGCDCSLNGASPGSLLRSVKRKYEEFENEKLFHIPELELDLS
SNAKVQIENELELLRETVSSQQQSIQDLYEELDEERNAASTAASEAMSMILRLQRDKAEL
QMELRQFKRFAEEKMEHDQQELLDLEDLIYKREQTIQALTFEAQAYKHRMMSFGFTEAEV
ETEKNMLSRNPSMIENDYQYDLPTSDYPPIKCNVNENPGPLEADIDVDDVEKYPLADSPH
PLKTLERRISQMERNPSFTQPTGDVSGGRHYTEKNVVGQSPRHQRHFRRVSTGSASSLLG
TTREKRLDFSNDSPRSNNGSFRKMEDPPYAAGNSFARDKGDSSEIGDNDMNDRVYTIDSV
HHSVSHSGTAEQKFKNDTADGYAMSPREISNQPDLGDPEISKLYMRLQALEADRESMRQA
IMSMRTEKAQMVLLKEIAQHLSKDVVPERRLPLRKTSIIGAFNFISVFKWITSFVFWRRK
ARRSKYMNGVQGNNMGLQMLLEKTPRIRQWRCLSSTQV

www.000webhost.com

Other information
Ka divergence:-0.18111KaKs divergence:-0.148312
GC content 1 (%):43GC content 2 (%):42GC content divergence:-0.012
Length 1 (bp):1515Length 2 (bp):1557Length divergence:0.014
MFE 1 (kcal):-448.21MFE 2 (kcal):-463.63MFE divergence0.017