Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G11910-AT5G06600
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):ubiquitin-specific protease 13
Function (paralog2):ubiquitin-specific protease 12

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.60779363127667
Log2 mRNA fold difference:0.55696765118939
Log2 TE fold difference:0.012486343835921
Sequences
Protein sequence

MTMMTPPPLDQQEDEEMLVPNPDLVEGPQPMEVAQTDPAATAVENPPPEDPPSLKFTWTI
PMFTRLNTRKHYSDVFVVGGYKWRILIFPKGNNVDHLSMYLDVADAANLPYGWSRYSQFS
LAVVNQVNNRYSIRKETQHQFNARESDWGFTSFMPLSELYEPTRGYLVNDTVLIEAEVAV
RKVLDYWSYDSKKETGFVGLKNQGATCYMNSLLQTLYHIPYFRKAVYHMPTTENDAPTAS
IPLALQSLFYKLQYNDTSVATKELTKSFGWDTYDSFMQHDVQELNRVLCEKLEDKMKGTV
VEGTIQKLFEGHHMNYIECINVDYKSTRKESFYDLQLDVKGCKDVYASFDKYVEVERLEG
DNKYHAEGHDLQDAKKGVLFIDFPPVLQLQLKRFEYDFMRDTMVKINDRYEFPLQLDLDR
EDGRYLSPDADKSVRNLYTLHSVLVHSGGVHGGHYYAFIRPTLSDQWYKFDDERVTKEDV
KRALEEQYGGEEELPQNNPGFNNPPFKFTKYSNAYMLVYIRESDKDKIICNVDEKDIAEH
LRVRLKKEQEEKEDKRKYKAQAHLFTTIKVARDDDITEQIGKNIYFDLVDHEKVRSFRIQ
KQTPFQQFKEEVAKEFGVPVQLQRFWIWAKRQNHTYRPNRPLSPNEELQTVGQIREASNK
ANNAELKLFLEIERGPDDLPIPPPEKTSEDILLFFKLYDPENAVLRYVGRLMVKSSSKPM
DIVGQLNKMAGFAPDEEIELFEEIKFEPCVMCEQIDKKTSFRLCQIEDGDIICYQKPLSI
EESEFRYPDVPSFLEYVQNRELVRFRTLEKPKEDEFTMELSKLHTYDDVVERVAEKLGLD
DPSKLRLTSHNCYSQQPKPQPIKYRGVDHLSDMLVHYNQTSDILYYEVLDIPLPELQGLK
TLKVAFHSATKDEVIIHNIRLPKQSTVGDVINELKTKVELSHQDAELRLLEVFFHKIYKI
FPSTERIENINDQYWTLRAEEIPEEEKNIGPNDRLIHVYHFTKEAGQNQQVQNFGEPFFL
VIHEGETLEEIKTRIQKKLHVPDEDFAKWKFASFSMGRPDYLLDTDVVYNRFQRRDVYGA
WEQYLGLEHIDNAPKRAYAANQNRHAYEKPVKIYN

MTMMTPPPVDQPEDEEMLVPNSDLVDGPAQPMEVTQPETAASTVENQPAEDPPTLKFTWT
IPNFSRQNTRKHYSDVFVVGGYKWRILIFPKGNNVDHLSMYLDVSDAASLPYGWSRYAQF
SLAVVNQIHTRYTVRKETQHQFNARESDWGFTSFMPLSELYDPSRGYLVNDTVLVEAEVA
VRKVLDYWSYDSKKETGFVGLKNQGATCYMNSLLQTLYHIPYFRKAVYHMPTTENDAPTA
SIPLALQSLFYKLQYNDTSVATKELTKSFGWDTYDSFMQHDVQELNRVLCEKLEDKMKGT
VVEGTIQQLFEGHHMNYIECINVDFKSTRKESFYDLQLDVKGCKDVYASFDKYVEVERLE
GDNKYHAEGHGLQDAKKGVLFIDFPPVLQLQLKRFEYDFMRDTMVKINDRYEFPLELDLD
REDGKYLSPDADRSVRNLYTLHSVLVHSGGVHGGHYYAFIRPTLSDQWYKFDDERVTKED
LKRALEEQYGGEEELPQTNPGFNNNPPFKFTKYSNAYMLVYIRESDKDKIICNVDEKDIA
EHLRVRLKKEQEEKEDKRRYKAQAHLYTIIKVARDEDLKEQIGKDIYFDLVDHDKVRSFR
IQKQTPFQQFKEEVAKEFGVPVQLQRFWIWAKRQNHTYRPNRPLTPQEELQPVGQIREAS
NKANTAELKLFLEVEHLDLRPIPPPEKSKEDILLFFKLYDPEKAVLSYAGRLMVKSSSKP
MDITGKLNEMVGFAPDEEIELFEEIKFEPCVMCEHLDKKTSFRLCQIEDGDIICFQKPLV
NKEIECLYPAVPSFLEYVQNRQLVRFRALEKPKEDEFVLELSKQHTYDDVVEKVAEKLGL
DDPSKLRLTSHNCYSQQPKPQPIKYRGVDHLSDMLVHYNQTSDILYYEVLDIPLPELQGL
KTLKVAFHHATKEEVVIHNIRLPKQSTVGDVINELKTKVELSHPDAELRLLEVFYHKIYK
IFPSTERIENINDQYWTLRAEEIPEEEKNIGPNDRLILVYHFAKETGQNQQVQNFGEPFF
LVIHEGETLEEIKNRIQKKLHVSDEDFAKWKFAFMSMGRPEYLQDTDVVYNRFQRRDVYG
AFEQYLGLEHADTTPKRAYAANQNRHAYEKPVKIYN

Other information
Ka divergence:-0.0775927KaKs divergence:0.697227
GC content 1 (%):41GC content 2 (%):41GC content divergence:0
Length 1 (bp):3348Length 2 (bp):3351Length divergence:0
MFE 1 (kcal):-940.33MFE 2 (kcal):-967.33MFE divergence0.014