Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G12020-AT5G06670
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):P-loop containing nucleoside triphosphate hydrolases superfamily protein
Function (paralog2):P-loop containing nucleoside triphosphate hydrolases superfamily protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-2.3290048272659
Log2 mRNA fold difference:-2.1058992513203
Log2 TE fold difference:-0.19532102480803
Sequences
Protein sequence

MASRQGSKSRKAGLKGADSTASSTTSSSKLYQETSIDGHSSPASSSAQSKQQFFSPDPLP
QTAQRSKENVTVTVRFRPLSPREIRQGEEVAWYADGETIVRNEHNPTIAYAYDRVFGPTT
TTRNVYDIAAHHVVNGAMEGINGTIFAYGVTSSGKTHTMHGDQRSPGIIPLAVKDAFSII
QETPNREFLLRISYMEIYNEVVNDLLNPAGHNLRIREDKQGTFVEGIKEEVVLSPAHALS
LIAAGEEQRHVGSTNFNLLSSRSHTIFTLTIESSPLGDKSKGEAVHLSQLNLVDLAGSES
SKVETSGVRRKEGSYINKSLLTLGTVISKLTDVRASHVPYRDSKLTRILQSSLSGHDRVS
LICTVTPASSSSEETHNTLKFAHRAKHIEIQAEQNKIIDEKSLIKKYQREIRQLKEELEQ
LKQEIVPVPQLKDIGADDIVLLKQKLEDGQVKLQSRLEEEEEAKAALLSRIQRLTKLILV
STKNPQASRLPHRFNPRRRHSFGEEELAYLPYKRRDMMDDEQLDLYVSVEGNHEIRDNAY
REEKKTRKHGLLNWLKPKKRDHSSSASDQSSVVKSNSTPSTPQGGGSHLHTESRLSEGSP
LMEQLSEPREDREALEDSSHEMEIPETSNKMSDELDLLREQKKILSEEAALQLSSLKRMS
DEAAKSPQNEEINEEIKVLNDDIKAKNDQIATLERQIMDFVMTSHEALDKSDIMQAVAEL
RDQLNEKSFELEVIELFLFMQFFFIYAEVRDGFAIAWIRLFILAQYYLSSYLNKVSSVYI
IKYQYSKRQTILTMKLMVCSTLFSHSSSCLQVKAADNRIIQQTLNEKTCECEVLQEEVAN
LKQQLSEALELAQGTKIKELKQDAKELSESKEQLELRNRKLAEESSYAKGLASAAAVELK
ALSEEVAKLMNQNERLAAELATQKSPIAQRNKTGTTTNVRNNGRRESLAKRQEHDSPSME
LKRELRMSKERELSYEAALGEKEQREAELERILEETKQREAYLENELANMWVLVSKLRRS
QGADSEISDSISETRQTEQTEGSF

MGSKQVSKTRNGGFSKLKTVESSASSTTSSSKLYQEASVDSHSSPTSSSVRSKPQLPPKP
LQSKENVTVTVRFRPLSPREIRKGEEIAWYADGETIVRNENNQSIAYAYDRVFGPTTTTR
NVYDVAAQHVVNGAMAGVNVTLSVNSTTGTIFAYGVTSSGKTHTMHGNQRSPGIIPLAVK
DAFSIIQETPRREFLLRVSYFEIYNEVVNDLLNPAGQNLRIREDEQGTYIEGIKEEVVLS
PAHVLSLIAAGEEHRHIGSTSFNLLSSRSHTMFTLTIESSPLGDNNEGGAVHLSQLNLID
LAGSESSKAETSGLRRKEGSYINKSLLTLGTVISKLTDRRASHVPYRDSKLTRLLESSLS
GHGRVSLICTVTPASSNSEETHNTLKFAHRAKHIEIQAAQNKIIDEKSLIKKYQYEIRQL
KEELEQLKQGIKPVSQLKDISGDDIDIVLLKQKLEEEEDAKAALLSRIQRLTKLILVSNK
TPQTSRFSYRADPRRRHSFGEEELAYLPHKRRDLTDDENLELYVSREGTPEIIDDAFIEE
KKTRKHGLLNWLKIKKKDSSLGGSSLSDKSSAVKSNSTPSTPQGEGSDFHTESRLSEGSA
LADQIIETMENREAHEDSFHEIETPETRIKMIDQMEILREQQKTLSEEMAQQSRSFKLLS
EEAAKAPQNEEIKAEIINLNGDIKAKNDQIATLGKQILDFVIASHDELDKSDIVQAVSEM
RAQLNEKCFELEVKAADNRIIQEQLTEKTSFCEDLQEEVANLKQQLSDALELGDINSVTC
HMQQSSQSPNKNEEKVIEAQAFEIEELKLKAAELSELNEQLEIRNKKLAEESSYAKELAS
AAAIELKALSEEIARLMNHNERLAADLAAVQKSSVTTPQGKTGNLRNGRRESVSKRKEQE
NSLMELKRELTVSKEREVSFEAALIEKIQREAELQRTVEESKQREAYLENELANMWGLVA
KLRSQGAANSGLSDSVSETRIEHFGT

www.000webhost.com

Other information
Ka divergence:0.164553KaKs divergence:0.231619
GC content 1 (%):42GC content 2 (%):42GC content divergence:0
Length 1 (bp):3135Length 2 (bp):2961Length divergence:-0.029
MFE 1 (kcal):-891.72MFE 2 (kcal):-849.44MFE divergence-0.024