Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G12030-AT5G06660
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein of unknown function DUF106, transmembrane
Function (paralog2):Protein of unknown function DUF106, transmembrane

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:1.7680638968161
Log2 mRNA fold difference:1.238614655842
Log2 TE fold difference:0.48207481640724
Sequences
Protein sequence

MATTIPLFASFKYADSLTVVGISFCTALVCEAISWILIYRTSSYKSLKYSIDKATKKLET
MKTENPSSKLSIKKSKTKKIDRVETSLKESSRDLSLFKFKSGAVVALVLFVVFGLLNSLF
EGKVVAKLPFHPITIVKKMSHRGLKGDDPTDCSMAFLYLLCSISIRTNLQKFLGFSPPRG
AAGAGGLFPMPDPKTN

MATAIPLFASFKYADSLTVVGISFCTALVCEAISWILIYRTSSYKSLKSSIDKASKKLET
MKTDNPSSKLTNKKSKTKKIDRVESSLKESSRDLSLFKFKSGAVVALVLFVVFGLLNSLF
EGKVVAKLPFHPITIVRKMSHRGLKGDDSTDCSMAFLYLLCSISIRTNLQKFLGFSPPRG
AAGAGGLFPMPDPKTN

www.000webhost.com

Other information
Ka divergence:-0.34269KaKs divergence:0.103448
GC content 1 (%):47GC content 2 (%):44GC content divergence:-0.033
Length 1 (bp):591Length 2 (bp):591Length divergence:0
MFE 1 (kcal):-165.1MFE 2 (kcal):-165.84MFE divergence0.002