Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G12130-AT5G06770
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):KH domain-containing protein / zinc finger (CCCH type) family protein
Function (paralog2):KH domain-containing protein / zinc finger (CCCH type) family protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-1.619899130846
Log2 mRNA fold difference:-1.4694861896098
Log2 TE fold difference:-0.14461177426807
Sequences
Protein sequence

MDTRKRGRPEAGSFNSNGGGYKKSKQEMESYSTGLGSKSKPCTKFFSTSGCPFGENCHFL
HYVPGGYNAVSQMTNMGPPIPQVSRNMQGSGNGGRFSGRGESGPGHVSNFGDSATARFSV
DASLAGAIIGKGGVSSKQICRQTGVKLSIQDHERDPNLKNIVLEGTLEQISEASAMVKDL
IGRLNSAAKKPPGGGLGGGGGMGSEGKPHPGSNFKTKICERFSKGNCTFGDRCHFAHGEA
ELRKSGIV

MDARKRGRPEAAASHNSNGGFKRSKQEMESISTGLGSKSKPCTKFFSTSGCPFGDNCHFL
HYVPGGYNAAAQMTNLRPPVSQVSRNMQGSGGPGGRFSGRGDPGSGPVSIFGASTSKISV
DASLAGAIIGKGGIHSKQICRETGAKLSIKDHERDPNLKIIELEGTFEQINVASGMVREL
IGRLGSVKKPQGIGGPEGKPHPGSNYKTKICDRYSKGNCTYGDRCHFAHGESELRRSGIA

www.000webhost.com

Other information
Ka divergence:0.0736534KaKs divergence:0.400825
GC content 1 (%):46GC content 2 (%):46GC content divergence:0
Length 1 (bp):747Length 2 (bp):723Length divergence:-0.016
MFE 1 (kcal):-236.82MFE 2 (kcal):-225.02MFE divergence-0.026