Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G12140-AT5G06780
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Emsy N Terminus (ENT)/ plant Tudor-like domains-containing protein
Function (paralog2):Emsy N Terminus (ENT)/ plant Tudor-like domains-containing protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.3130057559072
Log2 mRNA fold difference:-0.47108716056333
Log2 TE fold difference:0.19057040123398
Sequences
Protein sequence

METQIHQLEQEAYTAVLRAFKAQSDAISWEKESLITELRKELRVSDDEHRELLSRVNKDD
TIQRIRDWRQGGASQITRHATIQPFDVLPSPTFSAARKKQKTFPSYNPSIGATGNRSFNN
RLVSSGISGNESAEALIGRKVWTKWPEDNHFYEAIITQYNADEGRHALVYDIHAANETWE
WVDLKEIPPEDIRWDGEESGVALNIGHGSASFRGNRRGQIHGGRGRGPRIHQPRRELVPP
PTQQNGSGGRRTSSDDIELFNTDSLVKEVERVFDSTHPDPLELDKAKKMLKEHEQALIAA
IARLADTSDGEMGNNNKSTLRLVCNLRIIYYLPLNFCVMMIISSIITNLILGKIIRELIH
TCSACDFSVTCKQLNSLKYRSSS

MVGLHINMEAQIHILEQEAYSAVLRAFQAQADEFSWDKATVMTNLRKELRISDDENRQLL
NNVHNDDLIKRIRDSRPRGGNQVVRHQSLDVHPSPTFSASRKKQKTFQSYPSIGSTRSKS
FNNRVVSANEPAEALIGRKVWTKWPEDNSFYEAVVTQYNANEGRHALVYDINTVNETWEW
VDLNEIPTKDIRWDGEEDGVTLNVGHGGGTTRGNRRTLSHGGRGRGPRTQPRREHLATEN
GGGRKFFGEIELFNTDSLVKEVERVFDSNLPDPHELDKAKKLLKEHEQALIAAIARLTDA
SDYESDGEEPYSHELPMLLG

www.000webhost.com

Other information
Ka divergence:0.273019KaKs divergence:0.49434
GC content 1 (%):41GC content 2 (%):42GC content divergence:0.012
Length 1 (bp):1152Length 2 (bp):963Length divergence:-0.089
MFE 1 (kcal):-329.11MFE 2 (kcal):-258.15MFE divergence-0.121