Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G12170-AT5G06910
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Chaperone DnaJ-domain superfamily protein
Function (paralog2):J-domain protein 6

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:0.65055855921849
Log2 mRNA fold difference:1.4677954070557
Log2 TE fold difference:-0.8324800520285
Sequences
Protein sequence

MENDGRSNEKNLYEVLGVEATASPQEIRKAYHKLALRLHPDKNKDDEDAKEKFQQLQKVI
SILGDEEKRAVYDQTGSVDDADLSGDVVDNLRDFFKAMYKKVTEEDIEEFEANYRGSESE
KNDLIELYNKFKGKMSRLFCSMLCSNPKLDSHRFKDIIDEAIAAGEVKSTKAYKKWAKEI
AEMEPPTNPQKMRRKAAKAADKDLYAVMSQRGDERKEKFDSMFSSLVSRYGSNADSEPNE
EEFEAAQRKVESRRSSKKSRKK

MGRKKKSRASTTEEDEIEMDNAGPSSETSLYEVLGVERRATSQEIRKAYHKLALKLHPDK
NQDDKEAKDKFQQLQKVISILGDEEKRAVYDQTGSIDDADIPGDAFENLRDFFRDMYKKV
NEADIEEFEANYRGSESEKKDLLELFNKFKGKMNRLFCSMLCSDPKLDSHRFKDMLDEAI
AAGEVKSSKAYEKWANKISETKPPTSPLRKRKKKKSAAKDSETDLCLMIAKRQEERKGKV
DSMFSSLISRYGGDAEAEPTEEEFEAAQRRIESKRKPSKKSRGK

www.000webhost.com

Other information
Ka divergence:0.192907KaKs divergence:0.426139
GC content 1 (%):42GC content 2 (%):43GC content divergence:0.012
Length 1 (bp):789Length 2 (bp):855Length divergence:0.04
MFE 1 (kcal):-225.6MFE 2 (kcal):-232.67MFE divergence0.015