Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G12250-AT5G06960
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):TGACG motif-binding factor 6
Function (paralog2):OCS-element binding factor 5

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:1.7072926903478
Log2 mRNA fold difference:1.5232493937415
Log2 TE fold difference:0.18353489734267
Sequences
Protein sequence

MADTSSRTDVSTDGDTDHRDLGFYYLYNVTPGRLVPESLGKTWGILPSDRGHMHAAASDS
SDRSKDKLDQKTLRRLAQNREAARKSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGVF
ISSSGDQAHSTGGNGALAFDAEHSRWLEEKNRQMNELRSALNAHAGDTELRIIVDGVMAH
YEELFRIKSNAAKNDVFHLLSGMWKTPAERCFLWLGGFRSSELLKLLANQLEPMTERQVM
GINSLQQTSQQAEDALSQGMESLQQSLADTLSSGTLGSSSSDNVASYMGQMAMAMGQLGT
LEGFIRQADNLRLQTLQQMLRVLTTRQSARALLAIHDYSSRLRALSSLWLARPRE

MGDTSPRTSVSTDGDTDHNNLMFDEGHLGIGASDSSDRSKSKMDQKTLRRLAQNREAARK
SRLRKKAYVQQLENSRLKLTQLEQELQRARQQGVFISSSGDQAHSTAGDGAMAFDVEYRR
WQEDKNRQMKELSSAIDSHATDSELRIIVDGVIAHYEELYRIKGNAAKSDVFHLLSGMWK
TPAERCFLWLGGFRSSELLKLIASQLEPLTEQQSLDINNLQQSSQQAEDALSQGMDNLQQ
SLADTLSSGTLGSSSSGNVASYMGQMAMAMGKLGTLEGFIRQADNLRLQTYQQMVRLLTT
RQSARALLAVHNYTLRLRALSSLWLARPRE

www.000webhost.com

Other information
Ka divergence:0.295952KaKs divergence:-0.166432
GC content 1 (%):47GC content 2 (%):45GC content divergence:-0.022
Length 1 (bp):1068Length 2 (bp):993Length divergence:-0.036
MFE 1 (kcal):-346.83MFE 2 (kcal):-296.24MFE divergence-0.079