Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G12320-AT5G06980
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.22913724250936
Log2 mRNA fold difference:0.43213270346746
Log2 TE fold difference:-0.74794209739214
Sequences
Protein sequence

MDCYAEELVVPNYQESSSETYPSTGMWGGWSMSSPEAAEKCFDYDGFNGEGMMYSQMSMR
TSEEEEESKRSKAFYGASSLHDFEGIEQMDDMFLSSILEDVPEDDGDVHRATSSNNSVGS
SSMYGGGREVPMFHCHDMSFKEEAPFTISDLSEENMLDSNYGDELSSEEFVLQDLQRASQ
KLTDETRKCFRDTFYRLARSSQDKSDSVSPNSEELLMQTSRYDYGDGNRFSREEEIESET
NSIDRAVANLTFNKMESNISNFPLSERVQ

MDRYSRRNLEDLVVPNYQETSDSYPSPDMWGTGWSMNSSEAAEKCFDYDVIHNGFSGGLY
SQMEMDMGTSEQVEEETKKLKASGCFDRSLHDFDEIQHMDDMFFSILEDVPGNENFLSFK
ESDNNNSSSSSYLDTTDGREVPLFHYNWETCQDMPLMEEDAPMNLCEENKEEASAEEVVL
QDLQRATEMLTDDTRKCFRDTFYRLAKNSQQKSDSNSDEFLEDRTSSNDSSPSMTFLSVG
KLNLKPNSIDRAVANLTFNKMESNMRNMPPPKRLSSVQG

Other information
Ka divergence:0.124357KaKs divergence:0.768934
GC content 1 (%):41GC content 2 (%):42GC content divergence:0.012
Length 1 (bp):810Length 2 (bp):840Length divergence:0.018
MFE 1 (kcal):-228.5MFE 2 (kcal):-229.97MFE divergence0.003