Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G13080-AT3G13090
Species:Arabidopsis
Duplication type:TD
Function (paralog1):multidrug resistance-associated protein 3
Function (paralog2):multidrug resistance-associated protein 8

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-2.1219733049946
Log2 mRNA fold difference:-2.6212597836667
Log2 TE fold difference:0.53054998265593
Sequences
Protein sequence

MDFLGSTTGSGTLAMLFSFSESILPLDSRSFLLKPLFLRWLSGFLHSVLLLVLFFSWVRK
KIRGDSGVTESLKDRRDFGFKSALFCSLALSLLNLVLMSLSGFYWYESGWLDNEQLVSSL
GFLLGMVSWGVLSICLHRCRDCEHKKAPFLLRLWLVFYLVVSCYSLVVDFVMYERRETVP
VHLLVFDIVAFIAAVFLGYVAVLKKDRSNSNGVLEEPLLNGGDSRVGGDDSVELNKTNGS
GEATPYSRAGILSLLTFSWMSPLIDIGNKKTLDLEDVPQLHDTDSVVGLAPKFRSMLESP
DGGERSGVTTFKLIKALYFTAQWEILVTAFFAFIYTVASYVGPALIDTFVQYLNGRRQYN
HEGYVLVITFFAAKIVECLSQRHWFFRLQKVGIRMRSALVAMIYEKGLTLSCQSKQGRTS
GEIINFMTVDAERIGNFSWYMHDPWMVLLQVGLALWILYRNLGLASIAALVATIIVMLIN
FPFGRMQERFQEKLMEAKDSRMKSTSEILRNMRILKLQGWEMKFLSKIFDLRKSEEGWLK
KYVYNSAVISFVFWGAPTLVSVSTFGACILLGIPLESGKILSALATFRILQEPIYNLPDT
ISMIVQTKVSLDRLASYLCLDNLQPDIVERLPKGSSDVAVEVINSTLSWDVSSSNPTLKD
INFKVFPGMKVAVCGTVGSGKSSLLSSLLGEVPKVSGSLKVCGTKAYVAQSPWIQSGKIE
DNILFGKPMERERYDKVLEACSLSKDLEILSFGDQTVIGERGINLSGGQKQRIQIARALY
QDADIYLFDDPFSAVDAHTGSHLFKEVLLGLLCSKSVIYVTHQVEFLPAADLILVMKDGR
ISQAGKYNDILNSGTDFMELIGAHQEALAVVDSVDANSVSEKSALGQENVIVKDAIAVDE
KLESQDLKNDKLESVEPQRQIIQEEEREKGSVALDVYWKYITLAYGGALVPFILLGQVLF
QLLQIGSNYWMAWATPVSEDVQAPVKLSTLMIVYVALAFGSSLCILLRATLLVTAGYKTA
TELFHKMHHCIFRSPMSFFDSTPSGRIMSRASTDQSAVDLELPYQFGSVAITVIQLIGII
GVMSQVSWLVFLVFIPVVAASIWYQRYYIAAARELSRLVGVCKAPLIQHFSETISGATTI
RSFSQEFRFRSDNMRLSDGYSRPKFYTAGAMEWLCFRLDMLSSLTFVFSLVFLVSIPTGV
IDPSLAGLAVTYGLSLNTLQAWLIWTLCNLENKIISVERILQYASVPSEPPLVIESNRPE
QSWPSRGEVEIRDLQVRYAPHMPLVLRGITCTFKGGLRTGIVGRTGSGKSTLIQTLFRIV
EPSAGEIRIDGVNILTIGLHDLRLRLSIIPQDPTMFEGTMRSNLDPLEEYTDDQIWEALD
KCQLGDEVRKKEQKLDSSVSENGDNWSMGQRQLVCLGRVLLKRSKILVLDEATASVDTAT
DNLIQKTLREHFSDCTVITIAHRISSVIDSDMVLLLSNGIIEEYDTPVRLLEDKSSSFSK
LVAEYTSRSSSSFD

MENPIDSLLLQPIYLSVLSFFLNLVLLLILFGSWLFKKRVACEDTDAIMNEEFKHISFSY
NKLVLICCVSLSVFYSVLSLLSCLHWHTNGWPFLDLLLAALTWGSISVYLFGRYTNSCEQ
KVLFLLRVWWVFFFVVSCYHLVVDFVLYKKQEMVSVHFVISDLVGVCAGLFLCCSCLWKK
GEGERIDLLKEPLLSSAESSDNEEVTAPFSKAGILSRMSFSWMSPLITLGNEKIIDIKDV
PQLDRSDTTESLFWIFRSKLEWDDGERRITTFKLIKALFLSVWRDIVLSALLAFVYTVSC
YVAPYLMDNFVQYLNGNRQYKNQGYVLVTTFFVAKLVECQTQRQWFFRGQKAGLGMRSVL
VSMIYEKGLTLPCHSKQGHTSGEIINLMAVDADRISAFSWFMHDPWILVLQVSLALWILY
KSLGLGSIAAFPATILVMLANYPFAKLEEKFQSSLMKSKDNRMKKTSEVLLNMKILKLQG
WEMKFLSKILELRHIEAGWLKKFVYNSSAINSVLWAAPSFISATAFGACLLLKIPLESGK
ILAALATFRILQGPIYKLPETISMIVQTKVSLNRIASFLCLDDLQQDVVGRLPSGSSEMA
VEISNGTFSWDDSSPIPTLRDMNFKVSQGMNVAICGTVGSGKSSLLSSILGEVPKISGNL
KVCGRKAYIAQSPWIQSGKVEENILFGKPMEREWYDRVLEACSLNKDLEILPFHDQTVIG
ERGINLSGGQKQRIQIARALYQDADIYLFDDPFSAVDAHTGSHLFKEVLLGLLRHKTVIY
VTHQVEFLPEADLILVMKDGKITQAGKYHEILDSGTDFMELVGAHTEALATIDSCETGYA
SEKSTTDKENEVLHHKEKQENGSDNKPSGQLVQEEEREKGKVGFTVYKKYMALAYGGAVI
PLILVVQVLFQLLSIGSNYWMTWVTPVSKDVEPPVSGFTLILVYVLLAVASSFCILIRAL
LVAMTGFKMATELFTQMHLRIFRASMSFFDATPMGRILNRASTDQSVADLRLPGQFAYVA
IAAINILGIIGVIVQVAWQVLIVFIPVVAACAWYRQYYISAARELARLAGISRSPVVHHF
SETLSGITTIRSFDQEPRFRGDIMRLSDCYSRLKFHSTGAMEWLCFRLELLSTFAFASSL
VILVSAPEGVINPSLAGLAITYALNLNTLQATLIWTLCDLENKMISVERMLQYTNIPSEP
PLVIETTRPEKSWPSRGEITICNLQVRYGPHLPMVLHGLTCTFPGGLKTGIVGRTGCGKS
TLIQTLFRIVEPAAGEIRIDGINILSIGLHDLRSRLSIIPQDPTMFEGTIRSNLDPLEEY
TDDQIWEALDNCQLGDEVRKKELKLDSPVSENGQNWSVGQRQLVCLGRVLLKRSKLLVLD
EATASIDTATDNLIQETLRHHFADCTVITIAHRISSVIDSDMVLLLDQGLIKEHDSPARL
LEDRSSLFSKLVAEYTTSSESKSKRS

www.000webhost.com

Other information
Ka divergence:0.317337KaKs divergence:0.277133
GC content 1 (%):43GC content 2 (%):42GC content divergence:-0.012
Length 1 (bp):4545Length 2 (bp):4401Length divergence:-0.016
MFE 1 (kcal):-1426.37MFE 2 (kcal):-1347.44MFE divergence-0.028