Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G13290-AT3G13300
Species:Arabidopsis
Duplication type:TD
Function (paralog1):varicose-related
Function (paralog2):Transducin/WD40 repeat-like superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.6578759531961
Log2 mRNA fold difference:1.3567750764291
Log2 TE fold difference:0.21148341668157
Sequences
Protein sequence

MASSPGNTNPHNPPPFDLGTIFKPSSNPYPPPTGPFLNNQYNQQLYAPPGIAAQPSPVNQ
TQQDVSSSSSATNLQPQRTLSYPTPPLNPQSPRVNHNPGTHILALLNNGGAVANQEPSHH
NEIARAFPGGSGPIHVPSGKMPKGRRLVGEHAVYDVDVRLQGEIQPQLEVTPITKYGSDP
QLVLGRQIAVNKVYICYGLKGGSIRVLNINTALRSLFRGHSQRVTDMAFFAEDVHLLASV
SLDGKVFVWKISEGSEGDEQSQITGKIVVALQILGEEDTKHPRVCWHCHKQEILVVSIGK
HVLRIDTTKVGRGEVFSAEAPLQCHLDKLIDGVQIVGKHDGEVTDLSMCQWMTTRLVSSS
VDGTVKIWQDRKTQPLVVLRPHDGLPVNSAIFVTSPERPDHIILITGGPLNREIKIWVSA
GEEGWLLPADTESWRCTQTLDLKSSTEPQAEKAFFNQVIALSEAGLLLLANARRNAIYSV
HLDYGSSPVETLMDYLSEFTVTMPILSFIGTNDHPEEPFVKVYCVQTLAIQQYTLDLFLC
MPPPRENVGFEKSDSTVSREANLVESTLETSGMKPTELPSVGSVPKPSILVNRSENANML
SFPAGPASAGITPPAIVPPNGEPKTSGMPSETSDVDSAYAPSPQLPLSPRLSSKLSGYHT
PVEAFEQVLPHHKLGGKTSSADYFYVRQTDDVGGRNLDVSSVEENCRSKDTNVTPDDDVS
GIRSPSAFFKQPTHLVTPSEILMGVSSTEASITTEDKRDRDANIEEVNNDARGLEVELKE
VGEAQTSQNGEINYHETTENHTSESRENIFCSQASNLSTEMARDRHPITEGSAIPGDSMA
YGQPLQAGDERGLDSRDVSAKLPESGSSSGLVATNSKGKKQKAKNSQGPGLSSTSSNVAN
LADSFNEQSQSLNHPMADLLPQLLALQETMTQVMASQKEMQRQLSNAVTGPIVKEGKKLE
VALGRMIEKSSKSNADALWAHFQEEAVKNEKALRDHGQQIMNETTNFTSKELNAMFEKTM
KKEFASVGPTLARVVTPVIEKTVSSAITESFQRGIGDKAVNQLEKSVNSKLETTVARQIQ
AQFQTSGRQVLQEGLRSSMESSVIPSFERSCKTMFEQVDSTLQKGIGKHTSATQQRIDSG
QSQLAHTLRETISSASSVTQALNRELAESQRNRLALTAAGSNPLVTQLSNGPLGALLEKV
EAPMDPTTELSRLISERKYEESFTSALQRSDVSIVSWLCSQVDLRGLLAMNPLPLSQGVL
LSLLQQLACDISTDTSRKLGWMTDVVTAINPSDQMIAVHARPIFEQVYQILHHHRNAPGS
DVSAVRLIMHVINSLLMSCK

MASSPGNTNPHNTPPFDLGILFKPSSNPYPPPAASYPPPTGPFLHNQYDQQHYAPPGISA
QPSPVTQQQQDVSSSSAATNLHPQRTLSYPTPPLNLQSPRSNHNPGTHILALLNNTNNGA
PVANQEPSHQLPVVNHNEIARSFPGGSGPIRVPSCKLPKGRRLIGEHAVYDVDVRLQGEI
QPQLEVTPITKYGSDPQLVVGRQIAVNKVYICYGLKGGNIRVLNINTALRSLFRGHSQRV
TDMAFFAEDVDMLASVSLDGKVFVWKISEGSEGEDQPQITGKIVLALQILGEEDTKHPRV
CWHCHKQEILVVSIGKHVLRIDTTKVGRGEVFSAEAPLQCPLDKLIDGVQIVGKHDGEVT
DLSMCQWMTTRLVSSSVDGTIKIWQDRKAQPLVVLRPHDGHPVSSATFVTSPERPDHIIL
ITGGPLNREMKIWVSAGEEGWLLPADAESWRCTQTLDLKSSTEPRAEEAFFNQVIALSEA
GLLLLANAKRNALYAVHLDYGSSPVGTRMDYLSEFTVTMPILSFIGTNDPPEEPIVKVYC
VQTLAIQQYTLDLCLCLPPPIENMGLEKSDSSVSREANLVEGMSEPSGLKPTDLPSVDSV
PKPSIIVNRSESANKLSFPSAEATSQAIVPPNGEPKTSGLPSQTSGAGSAYATLPQLPLS
PRLSSKLSGYHTPVEAIEPVIPHHELGGKTPSADYSVDRQMDAVGERNLDVSSVEEISRS
KDSNVTPDDDVSGMRSPSAFFKHPTHLVTPSEILMGVSSAEASITTEDRRDRDANIQDVN
NDPRDTEVEVKEISEARSTQNGEINDHDETENCTSENREKVFCSQVSNLSTEMARDCYPS
TEGTFIPGESKAYGQPIKAGDESGVDSRGGPAKLLKGKKQKAKNSQGPGLSSTSSNVANL
ADSFNEQSQSLSHPMTDLLPQLLAMQETMNQVMASQKEMQRQLSNAATGPIGKESKRLEV
ALGRMIEKSSKSNADALWARIQEETVKNEKALRDHAQQIVNATTNFMSKELNAMFEKTIK
KELAAIGPALARSVVPVIEKTVSSAITESFQRGIGDKAVNQLDKSVNIKLEATVARQIQA
QFQTSGKQALQEGLRSSVESSVIPSFEKACKAMFDQIDSAFQKGIAEHTNAAQQRFDSGH
SQLAHTLKESITSASSVAQALSRELAETQRNLLALAAAGANSGGSNSLVTQLSGGPLGAL
LEKVEAPMDPTTELSRLISERKYEESFTSALQRSDVSIVSWLCSQVDLRGLLAMNPLPLS
QGVLLSLLQQLACDISKDTSRKLAWMTDVVAAINPSDQMIAVHARPIFEQVYQILHHHRN
APGSDVSAIRLIMHVINSMLMGCK

Other information
Ka divergence:-0.351852KaKs divergence:-0.419401
GC content 1 (%):45GC content 2 (%):46GC content divergence:0.011
Length 1 (bp):4023Length 2 (bp):4035Length divergence:0.001
MFE 1 (kcal):-1236.09MFE 2 (kcal):-1259.12MFE divergence0.009