Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G13710-AT3G13720
Species:Arabidopsis
Duplication type:TD
Function (paralog1):prenylated RAB acceptor 1.F4
Function (paralog2):PRA1 (Prenylated rab acceptor) family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:3.7630978213068
Log2 mRNA fold difference:3.4712442388494
Log2 TE fold difference:0.38135696253375
Sequences
Protein sequence

MANNDEITTSSHASPAVNHESISRAKQRIKDGLATRRSWRVMFDLHSTGLPHGVSDVFSR
IKTNLAYFRSNYAIVILNVIFFSLIWHPTSLIVFTGLVFLWIFLYFLRDVPLKVFRFQID
DRAVLIGLSVITIVLLLLTNATFNIVAALMAGAVLVLIHAVIRKTDDLFLDEEAATTETS
GLTSHPSS

MTNYGAIPTSSHASPLVDVESLSRAKHRIKAGLATRRAWRVMFDFHSMGLPHGVSDAFTR
IKTNLAYFRMNYAIVVLIVIFFSLIWHPTSLIVFTVLVVVWIFLYFLRDEPIKLFRFQID
DRTVLIVLSVLTVVLLLLTNATFNIVGALVTGAVLVLIHSVVRKTEDLFLDEEAATTETS
GLTSYPST

www.000webhost.com

Other information
Ka divergence:-0.546224KaKs divergence:0.451948
GC content 1 (%):47GC content 2 (%):49GC content divergence:0.021
Length 1 (bp):567Length 2 (bp):567Length divergence:0
MFE 1 (kcal):-164.34MFE 2 (kcal):-185.8MFE divergence0.061