Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G14130-AT3G14150
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Aldolase-type TIM barrel family protein
Function (paralog2):Aldolase-type TIM barrel family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.22225868054792
Log2 mRNA fold difference:0.53177353721991
Log2 TE fold difference:-0.73863705431594
Sequences
Protein sequence

MDQIVNVDEFQELAKQALPKMYYDFYNGGAEDQHTLNENVQAFRRIMFRPRVLVDVSNID
MSTSMLGYPISAPIMIAPTAMHKLAHPKGEIATAKAAAACNTIMIVSFMSTCTIEEVASS
CNAVRFLQIYVYKRRDVTAQIVKRAEKAGFKAIVLTVDVPRLGRREADIKNKMISPQLKN
FEGLVSTEVRPNEGSGVEAFASSAFDASLSWKDIEWLRSITKLPILVKGLLTREDALKAV
EAGVDGIVVSNHGARQLDYSPATITVLEEVVHAVKGRIPVLLDGGVRRGTDVFKALALGA
QAVLIGRPIVYGLAAKGEDGVKKVIDMLKNEFEITMALSGCPTIDDVTRNHVRTENERIK
SML

MDQIVNVDEFQELAKQALPKMYYDFYNGGAEDQHTLNENVQAFRRIMFRPRVLVDVSKID
MSTKILGYPISAPIMIAPTGNHKLAHPEGETATAKAAAACNTIMIVSYMSSCTFEEIASS
CNAVRFLQIYVYKRRDITAQVVKRAEKAGFKAIVLTVDVPRLGRREADIKNKMISPQLKN
FEGLFSTEVRPSKGSGVQAFASRAFDASFSWKDIEWLRSITELPILVKGILTREDALKAV
EAGVDGIIVSNHGGRQLDYSPATITVLEEVVQVVRGRIPVLLDGGVRRGTDVFKALALGA
QAVLIGRPIIYGLAAKGEDGVKKVIDMLKNEFEITMALSGCPTIDDITRNHVRTENERLH
SML

Other information
Ka divergence:0.337571KaKs divergence:-0.999768
GC content 1 (%):43GC content 2 (%):42GC content divergence:-0.012
Length 1 (bp):1092Length 2 (bp):1092Length divergence:0
MFE 1 (kcal):-336.01MFE 2 (kcal):-324MFE divergence-0.018