Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G14210-AT3G14220
Species:Arabidopsis
Duplication type:TD
Function (paralog1):epithiospecifier modifier 1
Function (paralog2):GDSL-like Lipase/Acylhydrolase superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-4.5346082770092
Log2 mRNA fold difference:-4.5744779699463
Log2 TE fold difference:-0.0038460541334047
Sequences
Protein sequence

MADNLNLVSVLGVLLVLTIFHNPIIVYAGEGVPNVALFTFGDSYYDAGNKVFLSQRKDLP
QTYWPYGKSRDYPNGKFSDGHIVPDFIADFISIPNGVLPPVLKPGVDISRGVSFAVADAS
ILGAPVESMTLNQQVVKFKNMKSNWNDSYIEKSLFMIYIGTEDYLNFTKANPNADASAQQ
AFVTNVINRLKNDIKLLYSLGASKFVVQLLAPLGCLPIVRQEYKTGNECYELLNDLAKQH
NGKIGPMLNEFAKISTSPYGFQFTVFDFYNAVLRRIATGRSLNYRFFVTNTSCCGVGTHN
AYGCGKGNVHSKLCEYQRSYFFFDGRHNTEKAQEEMAHLLYGADPDVVQPMTVRELIVYP
TGETMREYWEPNNLAIRRRPSRDFYLGLAAYY

MAKNRNLVFFLGVLASFTLSSFPVTVSGEPPILFTFGDSSYDVGNTKFFSSEFDPATTWP
YGDSIDDPSGRWSDGHIVPDFVGRLIGHREPIPPVLDPKADLSRGASFAIAGAVVLGSQS
TTASMNFGQQISKFLELHKQWTDKERAEAIYMVNIGAEDYLNFAKAHPNANTVEQLTQVA
HVLQRIPRELTSLYRAGGARKFAVQNLGPLGCLPIVRQEFKTGENCMEMVNFMVKTHNER
LSRLLVAITVPLLYRGFRYSLFDFNGEILRRINEPSLHGYTDTTTSCCGTGSRNAYGCGY
SNVHAKLCSYQKSFLFFDGRHNTEKTDEEVANLFYSGDKHVVSPMNIKDLVGKAATDLLA
QEI

Other information
Ka divergence:0.193634KaKs divergence:0.757727
GC content 1 (%):46GC content 2 (%):46GC content divergence:0
Length 1 (bp):1179Length 2 (bp):1092Length divergence:-0.038
MFE 1 (kcal):-341.6MFE 2 (kcal):-326.2MFE divergence-0.023