Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G14415-AT3G14420
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Aldolase-type TIM barrel family protein
Function (paralog2):Aldolase-type TIM barrel family protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-0.36079391474629
Log2 mRNA fold difference:-1.6141061707224
Log2 TE fold difference:1.2610833071578
Sequences
Protein sequence

MEITNVTEYDAIAKAKLPKMVYDYYASGAEDQWTLQENRNAFARILFRPRILIDVNKIDM
ATTVLGFKISMPIMVAPTAFQKMAHPDGEYATARAASAAGTIMTLSSWATSSVEEVASTG
PGIRFFQLYVYKNRKVVEQLVRRAEKAGFKAIALTVDTPRLGRRESDIKNRFTLPPNLTL
KNFEGLDLGKMDEASIDQIANDSGLASYVAGQIDRTLSWKDIQWLQTITNMPILVKGVLT
GEDARIAIQAGAAGIIVSNHGARQLDYVPATISALEEVVKATQGRVPVFLDGGVRRGTDV
FKALALGASGIFIGRPVVFALAAEGEAGVKKVLQMLRDEFELTMALSGCRSLSEITRNHI
VTEWDTPRHLPRL

MEITNVTEYDAIAKQKLPKMVYDYYASGAEDQWTLQENRNAFARILFRPRILIDVSKIDM
TTTVLGFKISMPIMVAPTAMQKMAHPDGEYATARAASAAGTIMTLSSWATSSVEEVASTG
PGIRFFQLYVYKNRNVVEQLVRRAERAGFKAIALTVDTPRLGRRESDIKNRFTLPPNLTL
KNFEGLDLGKMDEANDSGLASYVAGQIDRTLSWKDVQWLQTITKLPILVKGVLTGEDARI
AIQAGAAGIIVSNHGARQLDYVPATISALEEVVKATQGRIPVFLDGGVRRGTDVFKALAL
GASGIFIGRPVVFSLAAEGEAGVRKVLQMLRDEFELTMALSGCRSLKEISRNHITTEWDT
PRPSARL

www.000webhost.com

Other information
Ka divergence:-0.566193KaKs divergence:-0.231764
GC content 1 (%):47GC content 2 (%):49GC content divergence:0.021
Length 1 (bp):1122Length 2 (bp):1104Length divergence:-0.008
MFE 1 (kcal):-377.4MFE 2 (kcal):-369.5MFE divergence-0.011