Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G14460-AT3G14470
Species:Arabidopsis
Duplication type:TD
Function (paralog1):LRR and NB-ARC domains-containing disease resistance protein
Function (paralog2):NB-ARC domain-containing disease resistance protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:1.7929189840191
Log2 mRNA fold difference:2.3402894702707
Log2 TE fold difference:-0.56314431108754
Sequences
Protein sequence

MANSYLSSCANVMVERINTSQELVELCKGKSSSALLKRLKVALVTANPVLADADQRAEHV
REVKHWLTGIKDAFFQAEDILDELQTEALRRRVVAEAGGLGGLFQNLMAGREAIQKKIEP
KMEKVVRLLEHHVKHIEVIGLKEYSETREPQWRQASRSRPDDLPQGRLVGRVEDKLALVN
LLLSDDEISIGKPAVISVVGMPGVGKTTLTEIVFNDYRVTEHFEVKMWISAGINFNVFTV
TKAVLQDITSSAVNTEDLPSLQIQLKKTLSGKRFLLVLDDFWSESDSEWESFQVAFTDAE
EGSKIVLTTRSEIVSTVAKAEKIYQMKLMTNEECWELISRFAFGNISVGSINQELEGIGK
RIAEQCKGLPLAARAIASHLRSKPNPDDWYAVSKNFSSYTNSILPVLKLSYDSLPPQLKR
CFALCSIFPKGHVFDREELVLLWMAIDLLYQPRSSRRLEDIGNDYLGDLVAQSFFQRLDI
TMTSFVMHDLMNDLAKAVSGDFCFRLEDDNIPEIPSTTRHFSFSRSQCDASVAFRSICGA
EFLRTILPFNSPTSLESLQLTEKVLNPLLNALSGLRILSLSHYQITNLPKSLKGLKLLRY
LDLSSTKIKELPEFVCTLCNLQTLLLSNCRDLTSLPKSIAELINLRLLDLVGTPLVEMPP
GIKKLRSLQKLSNFVIGRLSGAGLHELKELSHLRGTLRISELQNVAFASEAKDAGLKRKP
FLDGLILKWTVKGSGFVPGSFNALACDQKEVLRMLEPHPHLKTFCIESYQGGAFPKWLGD
SSFFGITSVTLSSCNLCISLPPVGQLPSLKYLSIEKFNILQKVGLDFFFGENNSRGVPFQ
SLQILKFYGMPRWDEWICPELEDGIFPCLQKLIIQRCPSLRKKFPEGLPSSTEVTISDCP
LRAVSGGENSFRRSLTNIPESPASIPSMSRRELSSPTGNPKSDASTSAQPGFASSSQSND
DNEVTSTSSLSSLPKDRQTEDFDQYETQLGSLPQQFEEPAVISARYSGYISDIPSTLSPY
MSRTSLVPDPKNEGSILPGSSSYQYHQYGIKSSVPSPRSSEAIKPSQYDDDETDMEYLKV
TDISHLMELPQNLQSLHIDSCDGLTSLPENLTESYPNLHELLIIACHSLESFPGSHPPTT
LKTLYIRDCKKLNFTESLQPTRSYSQLEYLFIGSSCSNLVNFPLSLFPKLRSLSIRDCES
FKTFSIHAGLGDDRIALESLEIRDCPNLETFPQGGLPTPKLSSMLLSNCKKLQALPEKLF
GLTSLLSLFIIKCPEIETIPGGGFPSNLRTLCISLCDKLTPRIEWGLRDLENLRNLEIDG
GNEDIESFPEEGLLPKSVFSLRISRFENLKTLNRKGFHDTKAIETMEISGCDKLQISIDE
DLPPLSCLRISSCSLLTETFAEVETEFFKVLNIPYVEIDGEIFS

MTGIGEMFLAAFLQALFQTLVSEPFRSFFKRRELNENLLERLSTALLTITAVLIDAEEKQ
ITNPVVEKWVNELRDVVYHAEDALDDIATEALRLNIGAESSSSNRLRQLRGRMSLGDFLD
GNSEHLETRLEKVTIRLERLASQRNILGLKELTAMIPKQRLPTTSLVDESEVFGRDDDKD
EIMRFLIPENGKDNGITVVAIVGIGGVGKTTLSQLLYNDQHVRSYFGTKVWAHVSEEFDV
FKITKKVYESVTSRPCEFTDLDVLQVKLKERLTGTGLPFLLVLDDLWNENFADWDLLRQP
FIHAAQGSQILVTTRSQRVASIMCAVHVHNLQPLSDGDCWSLFMKTVFGNQEPCLNREIG
DLAERIVHKCRGLPLAVKTLGGVLRFEGKVIEWERVLSSRIWDLPADKSNLLPVLRVSYY
YLPAHLKRCFAYCSIFPKGHAFEKDKVVLLWMAEGFLQQTRSSKNLEELGNEYFSELESR
SLLQKTKTRYIMHDFINELAQFASGEFSSKFEDGCKLQVSERTRYLSYLRDNYAEPMEFE
ALREVKFLRTFLPLSLTNSSRSCCLDQMVSEKLLPTLTRLRVLSLSHYKIARLPPDFFKN
ISHARFLDLSRTELEKLPKSLCYMYNLQTLLLSYCSSLKELPTDISNLINLRYLDLIGTK
LRQMPRRFGRLKSLQTLTTFFVSASDGSRISELGGLHDLHGKLKIVELQRVVDVADAAEA
NLNSKKHLREIDFVWRTGSSSSENNTNPHRTQNEAEVFEKLRPHRHIEKLAIERYKGRRF
PDWLSDPSFSRIVCIRLRECQYCTSLPSLGQLPCLKELHISGMVGLQSIGRKFYFSDQQL
RDQDQQPFRSLETLRFDNLPDWQEWLDVRVTRGDLFPSLKKLFILRCPELTGTLPTFLPS
LISLHIYKCGLLDFQPDHHEYSYRNLQTLSIKSSCDTLVKFPLNHFANLDKLEVDQCTSL
YSLELSNEHLRGPNALRNLRINDCQNLQLLPKLNALPQNLQVTITNCRYLRQPMEQQPQY
HHPQFHLPRSNVSGSPKSHGSHRSYDSRSSSRYD

www.000webhost.com

Other information
Ka divergence:0.0705191KaKs divergence:-0.119466
GC content 1 (%):42GC content 2 (%):43GC content divergence:0.012
Length 1 (bp):4275Length 2 (bp):3165Length divergence:-0.149
MFE 1 (kcal):-1247.99MFE 2 (kcal):-953.37MFE divergence-0.134