Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G14610-AT3G14620
Species:Arabidopsis
Duplication type:TD
Function (paralog1):cytochrome P450, family 72, subfamily A, polypeptide 7
Function (paralog2):cytochrome P450, family 72, subfamily A, polypeptide 8

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-4.2075285789376
Log2 mRNA fold difference:-4.1327728559552
Log2 TE fold difference:-0.077132437490837
Sequences
Protein sequence

MSFSVVAALPVLVAVVVLWTWRIVKWVWIKPKMLESSLKRQGLTGTPYTPLVGDIKRNVD
MMMEARSKPINVTDDITPRLLPLALKMLNSHGKTFFIWIGPLPTIVITNPEQIKEVFNKV
NDFEKASTFPLIRLLAGGLASYKGDKWASHRRIINPAFHLEKIKNMIPAFYHCCSEVVCQ
WEKLFTDKESPLEVDVWPWLVNMTADVISHTAFGSSYKEGQRIFQLQGELAELIAQAFKK
SYIPGSRFYPTKSNRRMKAIDREVDVILRGIVSKREKAREAGEPANDDLLGILLESNSEE
SQGNGMSVEDVMKECKLFYFAGQETTSVLLVWTMVLLSHHQDWQARAREEVMQVLGENNK
PDMESLNNLKVMTMIFNEVLRLYPPVAQLKRVVNKEMKLGELTLPAGIQIYLPTILVQRD
TELWGDDAADFKPERFRDGLSKATKNQVSFFPFGWGPRICIGQNFAMLEAKMAMALILQK
FSFELSPSYVHAPQTVMTTRPQFGAHLILHKL

MSDTKISAVAVAAAVVVVTTVTVWIWKGLNVAWLRPKKNEAYLKRQGLSGTPFTFLVGDI
KREASMVEQEKSRPINLTDDYTHRVMPLIQQTVKDHGKTSYMWMGPIASVIVTKPEHIKD
VLNRVYDFPKPPVHPIVELFATGVALYEGEKWSKHRKIINPSFHLEKLKIMIPAFYESCS
EMISKWEKLVTEQGSSNEIDVWPYLGDLTSDVISRTAFGSSYEEGKRIFELQEEQGRRVL
KALELAFIPGMRFLPTKNNLRMRQINKEVKSRLREIIMKRQRGMDTGEAPKNDLLGILLE
SNSGDHGMSIEDVVEECRLFHFAGQETTAVLLVWTMIMLSHHQKWQDQAREEILKVIGKN
NKPNFDALSRLKTMSMILNEVLRLYPPGILLGRTVEKETKLGEDMTLPGGAQVVIPVLMV
HRDPELWGEDVHEFNPERFADGISKATKNQVSFLPFGWGPRFCPGQNFALMEAKMALVLI
LQRFSFELSPSYTHAPHTVLTLHPQFGAPLIFHML

www.000webhost.com

Other information
Ka divergence:0.10146KaKs divergence:0.177819
GC content 1 (%):44GC content 2 (%):43GC content divergence:-0.011
Length 1 (bp):1539Length 2 (bp):1548Length divergence:0.003
MFE 1 (kcal):-450.99MFE 2 (kcal):-466.5MFE divergence0.017