Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G16220-AT3G16230
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Predicted eukaryotic LigT
Function (paralog2):Predicted eukaryotic LigT

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:0.89202904941204
Log2 mRNA fold difference:0.87811980777303
Log2 TE fold difference:0.027773429743991
Sequences
Protein sequence

MENLNHKWDRCSSSHQTPLSFKGNQKQIGQGQREVFTHFVSLPLAIYPDLTKNIEAFQNS
VLGNNDKDPLKFQSTLAEMGIEKSIFVTPKTFHLTVVMLKLENNESVVKAQNILQSIFSN
VRQALKNRPVFIRLRGLECMSGSLDKTRVLYAPVEEVGREGRLLNACHVIIDAFENVGFA
GKDAKSRLKLHATLMNASYRKDKSKKMDTFDAREIHKEFENKDWGTYLIREAHISQRYKY
DPNGYFHCCASLPFPHK

MFAYRTLFRIDRVFGFTSRCFQSKPESFSILSFRGSEKSAMDGYKKQKMVNLVWRPISTQ
TSSVIAEAGNEVQEVAQCSKSSDVSKEVIEGETASVVSAGKHSVSLEVGASLIKFIRGKE
GTTQMKLEEEMGVKIILPSSRNKDHISIEGGSVDCVTKASKRIATIIDEVVRSPSLDYSH
FVSLPLAIHPELVDKLVNFQNSILGIHSIASDKQDDQANRATTSVAVDLKANSETNQVNV
GIKSIPIVSYPPKAKSKSSTLLDLGIEKSIFIKPSTFHLTVVMLKLWNKDRVNAACDVLK
SIFPSVMDALDNKPVFIRLKGLDCMRGPLDKTRVLYAPVEEIGDEGRLLRACQVITDAFV
KAGLVLEKDAKQSLKLHVTVMNARHRKRRKNNKKKMETFDAREIHKQFGNEDWGEYLIQE
AHLSQRFVFDQNGYYRCCGSIPFPGEQRA

www.000webhost.com

Other information
Ka divergence:-0.50124KaKs divergence:0.999548
GC content 1 (%):39GC content 2 (%):41GC content divergence:0.025
Length 1 (bp):774Length 2 (bp):1350Length divergence:0.271
MFE 1 (kcal):-195.42MFE 2 (kcal):-397.43MFE divergence0.341