Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G16650-AT4G15900
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Transducin/WD40 repeat-like superfamily protein
Function (paralog2):pleiotropic regulatory locus 1

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:3.0496700919695
Log2 mRNA fold difference:3.3624199310297
Log2 TE fold difference:-0.44789887812569
Sequences
Protein sequence

MTMIALNREVETQSLKKLSLKSVRRAREIFSPVHGQFPQPDPESKRIRLCHKIQVAFGGV
EPASKPTRIADHNSEKTAPLKALALPGPKGSKELRKSATEKALVVGPTLPPRDLNNTGNP
GKSTAILPAPGSFSERNLSTAALMERMPSRWPRPEWHAPWKNYRVLQGHLGWVRSVAFDP
SNEWFCTGSADRTIKIWDVATGVLKLTLTGHIGQVRGLAVSNRHTYMFSAGDDKQVKCWD
LEQNKVIRSYHGHLHGVYCLALHPTLDVVLTGGRDSVCRVWDIRTKMQIFVLPHDSDVFS
VLARPTDPQVITGSHDSTIKFWDLRYGKSMATITNHKKTVRAMALHPKENDFVSASADNI
KKFSLPKGEFCHNMLSLQRDIINAVAVNEDGVMVTGGDKGGLWFWDWKSGHNFQRAETIV
QPGSLESEAGIYAACYDQTGSRLVTCEGDKTIKMWKEDEDATPETHPLNFKPPKEIRRF

MPAPTTEIEPIEAQSLKKLSLKSLKRSLELFSPVHGQFPPPDPEAKQIRLSHKMKVAFGG
VEPVVSQPPRQPDRINEQPGPSNALSLAAPEGSKSTQKGATESAIVVGPTLLRPILPKGL
NYTGSSGKSTTIIPANVSSYQRNLSTAALMERIPSRWPRPEWHAPWKNYRVIQGHLGWVR
SVAFDPSNEWFCTGSADRTIKIWDVATGVLKLTLTGHIEQVRGLAVSNRHTYMFSAGDDK
QVKCWDLEQNKVIRSYHGHLSGVYCLALHPTLDVLLTGGRDSVCRVWDIRTKMQIFALSG
HDNTVCSVFTRPTDPQVVTGSHDTTIKFWDLRYGKTMSTLTHHKKSVRAMTLHPKENAFA
SASADNTKKFSLPKGEFCHNMLSQQKTIINAMAVNEDGVMVTGGDNGSIWFWDWKSGHSF
QQSETIVQPGSLESEAGIYAACYDNTGSRLVTCEADKTIKMWKEDENATPETHPINFKPP
KEIRRF

www.000webhost.com

Other information
Ka divergence:-0.400268KaKs divergence:-0.252407
GC content 1 (%):46GC content 2 (%):46GC content divergence:0
Length 1 (bp):1440Length 2 (bp):1461Length divergence:0.007
MFE 1 (kcal):-445.84MFE 2 (kcal):-432.49MFE divergence-0.015