Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G16660-AT3G16670
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Pollen Ole e 1 allergen and extensin family protein
Function (paralog2):Pollen Ole e 1 allergen and extensin family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:2.8951149447104
Log2 mRNA fold difference:0.3884117246896
Log2 TE fold difference:2.5671109750878
Sequences
Protein sequence

MAMLKNKHMTVSLILVCLVVVSPMAEAQLGLGGSGGLGGLIGGLVGGLGGLVGGLVGGIL
NLVNINGVVFCSLNGAPSGTSTPAFANAGVELQCGRQNRVVSTATTNAAGLFSLPTDSIQ
MLLSTLLSDCRVVVTTPLSTCNANLPSVGNLVSRLAMIGNSLTGLLNIISIIPAGFGLLN

MAVIKKHITFSLVLLCLIVVSPMANAQSGLGGINVPIINGVLFCTINGAPLNGTPAPAFA
NAVVQLQCGNLNRVVAETITNIAGLFTFSTNGIQISLPTLLNDCRIVVPTPRSSCDATLP
STGQLISQLNLVGSIVSGLLNIVAILPTGFIPTI

Other information
Ka divergence:0.585708KaKs divergence:-0.992408
GC content 1 (%):51GC content 2 (%):50GC content divergence:-0.01
Length 1 (bp):543Length 2 (bp):465Length divergence:-0.077
MFE 1 (kcal):-183.8MFE 2 (kcal):-114.1MFE divergence-0.234