Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G16690-AT4G15920
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Nodulin MtN3 family protein
Function (paralog2):Nodulin MtN3 family protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-0.45441502724832
Log2 mRNA fold difference:-0.92180637172937
Log2 TE fold difference:0.47635395247273
Sequences
Protein sequence

MADLSFYVGVIGNVISVLVFLSPVETFWRIVQRRSTEEYECFPYICTLMSSSLWTYYGIV
TPGEYLVSTVNGFGALAESIYVLIFLFFVPKSRFLKTVVVVLALNVCFPVIAIAGTRTLF
GDANSRSSSMGFICATLNIIMYGSPLSAIKTVVTTRSVQFMPFWLSFFLFLNGAIWGVYA
LLLHDMFLLVPNGMGFFLGIMQLLIYAYYRNAEPIVEDEEGLIPNQPLLA

MAEASFYIGVIGNVISVLVFLSPVETFWKIVKRRSTEEYKSLPYICTLLGSSLWTYYGIV
TPGEYLVSTVNGFGALVETIYVSLFLFYAPRHLKLKTVDVEAMLNVFFPIAAIVATRSAF
EDEKMRSQSIGFISAGLNIIMYGSPLSAMKTVVTTKSVKYMPFWLSFFLFLNGAIWAVYA
LLQHDVFLLVPNGVGFVFGTMQLILYGIYRNAKPVGLSNGLSEIAQDEEEGLTSRVEPLL
S

www.000webhost.com

Other information
Ka divergence:-0.0434337KaKs divergence:-0.588498
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):693Length 2 (bp):726Length divergence:0.023
MFE 1 (kcal):-190.34MFE 2 (kcal):-218.1MFE divergence0.068