Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G16700-AT4G15940
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Fumarylacetoacetate (FAA) hydrolase family
Function (paralog2):Fumarylacetoacetate (FAA) hydrolase family

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:3.733322619521
Log2 mRNA fold difference:3.6119765464508
Log2 TE fold difference:0.032980002087085
Sequences
Protein sequence

MATSMIQRLFKQGTKIVGVGLNYASHAKELGNALPKDPIVFLKPTSSYLENGGTIEIPHP
LDSLHHEVELAVVIGQKARDVPERLAMNYIGGYALALDMTARELQVSAMASGLPCTLAKG
QDTFTPISSVLPKAMVLDPNNLELWLKVDDETRQKGWTKDMIFKVPYLISYISSVMTLFK
GDVILTGTPEGIGPVKIGQKITAGITGLSEVQFDVGRRLKPLLR

MATSMIQRMFKQGTKIVCVGRNYAAHAKELGNAVPKEPVIFLKPTSSYLENGGTIEIPHP
LDSLHHEVELALVIGQKARDVPESIAMDYIGGYAVALDMTARELQASAKASGLPWTVAKG
QDTFTPISSVLPKAMVRDPDNLELWLKVDGETRQKGLTKDMIFKVPYLISYISSIMTLYG
DVILTGTPEGVGPVKIGQKITAGITGLSEVQFDVERRVKPLS

www.000webhost.com

Other information
Ka divergence:-0.683061KaKs divergence:0.945481
GC content 1 (%):46GC content 2 (%):46GC content divergence:0
Length 1 (bp):675Length 2 (bp):669Length divergence:-0.004
MFE 1 (kcal):-196.45MFE 2 (kcal):-200.4MFE divergence0.01