Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G16720-AT4G15975
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):TOXICOS EN LEVADURA 2
Function (paralog2):RING/U-box superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.6366521036447
Log2 mRNA fold difference:3.9445336879041
Log2 TE fold difference:-4.5878580766779
Sequences
Protein sequence

MNSNDQDPIPFRPEDNNFSGSKTYAMSGKIMLSAIVILFFVVILMVFLHLYARWYLLRAR
RRHLRRRSRNRRATMVFFTADPSTAATSVVASRGLDPNVIKSLPVFTFSDETHKDPIECA
VCLSEFEESETGRVLPNCQHTFHVDCIDMWFHSHSTCPLCRSLVESLAGIESTAAARERE
VVIAVDSDPVLVIEPSSSSGLTDEPHGSGSSQMLREDSGRKPAAIEVPRRTFSEFEDELT
RRDSPASQSFRSPMSRMLSFTRMLSRDRRSASSPIAGAPPLSPTLSCRIQMTESDIERGG
EESR

MLTTTILILLIVILMVSLHLYYRWYLLRSSPFNRTTAASTFFTDPSSTPGGLNPSIIKSL
PIFTFSAVTALFAMECSVCLSEFKDNESGRVMPNCKHTFHVDCIDMWFHSHSSCPLCRSL
IEPFAGGVKSTMDEVAISISDPVYGDTNHHEGTETTGDSVPEDSQRKPAAIEISQRNLGE
IENDLSRSHSFRSPTDEPDDIFHSEFESRSGEVLLLLLLLSEFRIFCFRRSVACK

www.000webhost.com

Other information
Ka divergence:0.653363KaKs divergence:-0.585965
GC content 1 (%):50GC content 2 (%):46GC content divergence:-0.042
Length 1 (bp):915Length 2 (bp):708Length divergence:-0.128
MFE 1 (kcal):-308.68MFE 2 (kcal):-193.8MFE divergence-0.229