Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G16860-AT4G16120
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):COBRA-like protein 8 precursor
Function (paralog2):COBRA-like protein-7 precursor

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:2.0218705990919
Log2 mRNA fold difference:1.8940363707325
Log2 TE fold difference:-0.036793891671268
Sequences
Protein sequence

MGLTRNFILWILLSSLFTAIQLTSSQRNTPPPRSKDADLCNGVFVSYTYLTGTKIKPNDT
KNQPYRFESEITVLNNGRDELKSWQVFVKFAHREILVSATNAVLSDGSSLPASVENGTIF
AGFPSADLKTAIMTAGDVTQMEARVELVGTQFGVAPPSVPLPKNITLVNDGWSCPKPTQQ
GSNVLQVCCTPNPNITTSKIGQKFLPRQEGDLTIMYDVTRAYQSSYSAQVTIENHNLLGR
LDNWDLSFMWMKDEFLFSTKGAYPSVVDSSDCITGPQAKYYKDLDFSNVMSCARRPHIID
LPLTKYNDTNVGRIPYCCRNGTILPRSMDPEKSKSVFQIEVYKMPPDLNISSITPPQSWQ
IKGNLNPDYKCGPPLRVSSSQFPDTSGLPSNKSAFASWQVVCNITQPTPPKCCVSFSSYF
NDSVIPCKTCACGGCSSDRVARTCSTTSPALPLPYQALLIPFDNRTKLTNAWAVLKNRKV
PDPLPCGDNCGVSINWHLATDYRGGWTARVTLFNWGDTDFVDWFTAVELRNAAPGFQKAY
SFNGSIIAVNGKNTTVLMEGLPGLNYLLAEKDGKNPSEDFRIPGKQQSVISFTKKLTPGI
KVGSKDGFPTKVLFNGQECSLPSVLPTSNSHRKHVSTFLLILTPFLALLFLRI

MDSAPNFIPRLLLLSLLIVSIPLTSSQSDANTTNPSPSPPSDSDLCNGVFVSYTHTKGSK
IPPNDTANQPYRFESVITVLNHGRDELKSWRVFVKFAHREILVSASNAVLSDGSSLPVSV
ENGTVFAGYPSSDLKSAIQTAGDVTQMQARVELVGTQFGVAPPNVPLPKNITLATDGWKC
PKATQKGTNVLQVCCIPDPDYDNREIIDNEFLPRKDGDLTIMYDVVRSYSSNYMAQVTME
NHNPLGRLDNWKLSFDWMRDEFIYTMKGAYPSIVDSSDCVDGPQAKHYQDLDFSNVLSCA
RRPTVIDLPPTKYNDSTFGLIPFCCRNGTILPRSMDPSKSSSVFQMQVYKMPPDLNISAL
SPPQNWRINGTLNPDYKCGPPVRVSPSQFVDPSGLPSNRTAFASWQVVCNITQPKDASPR
CCVSFSAYFNDSIVPCKTCACGCSSNKAARACSATAPSLLLPQQALLVPFENRTELTVAW
AYLKQRPVPNPMPCGDNCGVSINWHLATDYRGGWTARVTVFNWGETDFVDWFTAVQMKNA
APGFEKAYSFNASTIGINGKNNTIFMEGLPGLNYLVAERDGENPLKNPRIPGKQQSVMSF
TKKLTPGINVPGGDGFPSKVFFNGEECSLPTILPMRSSQHRKHISVFLLALPVLALLILR
A

www.000webhost.com

Other information
Ka divergence:-0.322927KaKs divergence:-0.228706
GC content 1 (%):47GC content 2 (%):48GC content divergence:0.011
Length 1 (bp):1962Length 2 (bp):1986Length divergence:0.006
MFE 1 (kcal):-579.4MFE 2 (kcal):-601.12MFE divergence0.018