Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G16940-AT4G16150
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):calmodulin binding;transcription regulators
Function (paralog2):calmodulin binding;transcription regulators

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.73318427722653
Log2 mRNA fold difference:0.52058947484741
Log2 TE fold difference:0.28100739700437
Sequences
Protein sequence

MDGDGLGRLIGSEIHGFHTLQDLDVQTMLEEAKSRWLRPNEIHAILYNPKYFTINVKPVN
LPNSGRIILFDRKMLRNFRKDGHNWKKKKDGRTVKEAHEHLKVGNEERIHVYYAHGEDNT
TFVRRCYWLLDKARENIVLVHYRDTQEAATTSGDSISSPISVSEQTFPNRVAAEDIDTVV
RNHDISLHDINTLDWDELLVPTDLNNQSAPTVDNLSYFTEPLQNAANGTAEHGNATVADG
SLDALLNDGPQSRESFGRWMNSFISESNGSLEDPSFEPMVMPRQDPLAPQAVFHSHSNIP
EQVFNITDVSPAWAYSSEKTKILVTGFLHDSYQHLERSNLYCVCGDFCVPAEYLQAGVYR
CIIPPHSPGMVNLYLSADGHKPISQCFRFEHRAVPVLDKTVPEDNQDSKWEEFEFQVRLS
HLLFTSSNKLNVLSSKISPHNLRDAKKLASKTNHLLNSWAYLVKSIQGNKVSFDQAKDHL
FELSLKNRLKEWLMEKVLEGRNTLDYDSKGLGVIHLCASLGYTWSVQLFSLSGLSLNFRD
KQGWTALHWAAYYGREKMVAALLSAGARPNLVTDSTKDNLGGCMAADLAQQNGYDGLAAY
LAEKCLVAQFRDMKIAGNITGDLEACKAEMLNQGTLPEDEQSLKDALAAYRTAAEAAARI
QGAFREKALKAARSSVIQFANKEEEAKSIIAAMKIQNAFRKYDTRRKIEAAYRIQCRFQT
WKIRREYLNMRRQAIRIQAAFRGLQARRQYKKILWSVGVLEKAVLRWRQKRKGFRGLQVA
AEEDSPGEAQEDFYKTSQRQAEERLERSVVRVQAMFRSKKAQQDYRRMKLTHEEAQLEYG
CLEDI

MAGVDSGKLIGSEIHGFHTLQDLDIQTMLDEAYSRWLRPNEIHALLCNHKFFTINVKPVN
LPKSGTIVLFDRKMLRNFRKDGHNWKKKKDGKTIKEAHEHLKVGNEERIHVYYAHGEDTP
TFVRRCYWLLDKSQEHIVLVHYRETHEVHAAPATPGNSYSSSITDHLSPKIVAEDTSSGV
HNTCNTGFEVRSNSLGSRNHEIRLHEINTLDWDELLVPADISNQSHPTEEDMLYFTEQLQ
TAPRGSVKQGNHLAGYNGSVDIPSFPGLEDPVYQNNNSCGAGEFSSQHSHCGVDPNLQRR
DFSATVTDQPGDALLNNGYGSQDSFGRWVNNFISDSPGSVDDPSLEAVYTPGQDSSTPPT
VFHSHSDIPEQVFNITDVSPAWAYSTEKTKILVTGFFHDSFQHLGRSNLICICGELRVPA
EFLQMGVYRCFLPPQSPGVVNLYLSVDGNKPISQLFSFEHRSVQFIEKAIPQDDQLYKWE
EFEFQVRLAHLLFTSSNKISVLTSKISPENLLEAKKLASRTSHLLNSWAYLMKSIQANEV
PFDQARDHLFELTLKNRLKEWLLEKVIENRNTKEYDSKGLGVIHLCAVLGYTWSILLFSW
ANISLDFRDKQGWTALHWAAYYGREKMVAALLSAGARPNLVTDPTKEFLGGCTAADLAQQ
KGYDGLAAFLAEKCLVAQFKDMQTAGNISGNLETIKAEKSSNPGNANEEEQSLKDTLAAY
RTAAEAAARIQGAFREHELKVRSSAVRFASKEEEAKNIIAAMKIQHAFRNFEVRRKIAAA
ARIQYRFQTWKMRREFLNMRKKAIRIQAAFRGFQVRRQYQKITWSVGVLEKAILRWRLKR
KGFRGLQVSQPDEKEGSEAVEDFYKTSQKQAEERLERSVVKVQAMFRSKKAQQDYRRMKL
AHEEAQLEYDGMQELDQMATEES

Other information
Ka divergence:-0.208593KaKs divergence:-0.267338
GC content 1 (%):45GC content 2 (%):45GC content divergence:0
Length 1 (bp):2538Length 2 (bp):2772Length divergence:0.044
MFE 1 (kcal):-772.19MFE 2 (kcal):-853.5MFE divergence0.05