Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G17690-AT3G17700
Species:Arabidopsis
Duplication type:TD
Function (paralog1):cyclic nucleotide gated channel 19
Function (paralog2):cyclic nucleotide-binding transporter 1

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-0.80948982047586
Log2 mRNA fold difference:-1.5136024323701
Log2 TE fold difference:0.73972699676681
Sequences
Protein sequence

MAHTRTFTSRNRSVSLSNPSFSIDGFDNSTVTLGYTGPLRTQRIRPPLVQMSGPIHSTRR
TEPLFSPSPQESPDSSSTVDVPPEDDFVFKNANLLRSGQLGMCNDPYCTTCPSYYNRQAA
QLHTSRVSASRFRTVLYGDARGWAKRFASSVRRCLPGIMNPHSKFVQVWTRVLAFSSLVA
IFIDPLFFFLLLIQQDNKCIAIDWRATKVLVSLRSITDLIFFINILLQFRLAYVAPESRI
VGAGQLVDHPRKIARHYFRGKFLLDMFIVFPIPQIMILRIIPLHLGTRREESEKQILRAT
VLFQYIPKLYRLLPLLAGQTSTGFIFESAWANFVINLLTFMLAGHAVGSCWYLSALQRVK
KCMLNAWNISADERRNLIDCARGSYASKSQRDLWRDNASVNACFQENGYTYGIYLKAVNL
TNESSFFTRFSYSLYWGFQQISTLAGNLSPSYSVGEVFFTMGIIGLGLLLFARLIGNMHN
FLQSLDRRRMEMMLRKRDVEQWMSHRRLPEDIRKRVREVERYTWAATRGVNEELLFENMP
DDLQRDIRRHLFKFLKKVRIFSLMDESVLDSIRERLKQRTYIRSSTVLHHRGLVEKMVFI
VRGEMESIGEDGSVLPLSEGDVCGEELLTWCLSSINPDGTRIKMPPKGLVSNRNVRCVTN
VEAFSLSVADLEDVTSLFSRFLRSHRVQGAIRYESPYWRLRAAMQIQVAWRYRKRQLQRL
NTAHSNSNR

MASHNENDDIPMLPISDPSSRTRARAFTSRSRSVSLSNPTSSIEGFDTSTVVLGYTGPLR
TQRRPPLVQMSGPLTSTRKHEPLFLPHPSSDSVGVSSQPERYPSFAALEHKNSSEDEFVL
KHANLLRSGQLGMCNDPYCTTCPSYYNRKAAQIPTSRVSALFDSTFHNALYDDAKGWARR
FASSVNRYLPGIMNPHAKEVQTWTKFFALSCLLAIFIDPLFFFLIKVQEQNKCIMIDWPM
TKAFVAVRSVTDVIFTMNILLQFRLAYVARESTVVGAGQLVSHPKKIALHYLKGKFFLDL
FIVMPLPQILILWIIPAHLGASGANYAKNLLRAAVLFQYIPKLYRLLPFLAGQTPTGFIF
ESAWANFVINLLTFMLAGHVVGSCWYLFGLQRVNQCLRNACGNFGRECQDLIDCGNGNSS
VLVRATWKDNASANACFQEDGFPYGIYLKAVNLTNHSNLFTRYSYSLFWGFQQISTLAGN
QVPSYFLGEVFFTMGIIGLGLLLFALLIGNMQNFLQALGKRNLEMTLRRRDVEQWMSHRR
LPDGIRRRVREAERFNWAATRGVNEELLFENMPDDLQRDIRRHLFKFLKKVRIFSLMDEP
ILDAIRERLKQRTYIGSSTVLHRGGLVEKMVFIVRGEMESIGEDGSVLPLYEGDVCGEEL
LTWCLERSSVNPDGTRIRMPSKGLLSSRNVRCVTNVEAFSLSVADLEDVTSLFSRFLRSH
RVQGAIRYDSPYWRLRAARQIQVAWRYRRRRLHRLCTPQSSYSL

www.000webhost.com

Other information
Ka divergence:-0.412204KaKs divergence:0.103661
GC content 1 (%):42GC content 2 (%):43GC content divergence:0.012
Length 1 (bp):2190Length 2 (bp):2295Length divergence:0.023
MFE 1 (kcal):-652.52MFE 2 (kcal):-665.52MFE divergence0.01