Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G17712-AT3G17740
Species:Arabidopsis
Duplication type:TD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.094800983586275
Log2 mRNA fold difference:0.3089833183649
Log2 TE fold difference:-0.59244436487597
Sequences
Protein sequence

MWVDYRTQHRPIHDPWHKKNTESVLFFPVDVMSNTPEDGDGAQVTTGGLFPVFPTSANSI
SAISNAPQWLRNASFTTDLSVINAAASTAPSSSEVEAGDDEDEEGGADGNIGLANQARVY
NLVEEEGSLESDDDKVKRKREKKKKRKSDNASDESRSRKSDEYYSKPVKDYYLDTRPDPD
NLAYGSIYRMNVPRYKLDNSQRVPGSGSLRFYLRNRRSSMLDTEIDIDSLEGRAKSDTRY
WYAKHAAMERNKNFKRIRLSAASEAVDSSFDNFIPLEEDVTVPESDEEDVLSKDSMIGAS
WEDEVLNKTREFNRVTRERPHDAKAWLAFADFQDKVSSMQSQKGVRLQTLEKKISILEKA
FELNPDSEELLLALLKAYRSRDNADVLIREFSRFKVSEVRRLYSYAIQALSSACSKRHRQ
VDTTSEPLDSAAIQQELVLVDMLVSLCRFEWQAGYQELATALLQAEVEFSIFSPSLLLTE
QSKLRLFEHFWSSNGARVGEEGAFGWLLWLEKEEENRQKILKEESSDDNEVGGWTGWTEQ
VSGRNGDDLASANTGEVDVDRKGLDEEMEDENSKPEDDTEAMLKLLGIDVNTAASDEVKD
TSTWVEWFEEEVSRDHSQWMPTRKAGEFSSVEGMGEGEDEEQLSSVVLYEDINGYLFSLR
SKEARLSLVYQFIDFFGAHISPMDFQQQLSWSEKISSLETLSDSMLENLRSVHECLSKSD
SANCFSLGSLLGGSCDLSMRTEMMKFLRNAILLCLNVFPQNYIPEEAVLVTEELFVTNMK
TCEDLLLCGVYAQREAASGNMKHARRVFDMALTSICGLPKVSFRSFGYVVSGAYDTKFQV
STYVSNSEELLISFLC

MSNTPEDGDGAQVTTGGLFPVFPTSANSISAISNAPQWLRNASFTTDLSVINAAASTAPS
SSEVEAGDDEDEEGGADGNIGLANQARVYNLVEEEGSLESDDDKVKRKREKKKKRKSDNA
SDESRSRKSDEYYSKPVKDYYLDTRPDPDNLAYGSIYRMNVPRYKLDNSQRVPGSGSLRF
YLRNRRSSMLDTEIDIDSLEGRAKSDTRYWYAKHAAMERNKNFKRIRLSAASEAVDSSFD
NFIPLEEDVTVPESDEEDVLSKDSMIGASWEDEVLNKTREFNRVTRERPHDAKAWLAFAD
FQDKVSSMQSQKGVRLQTLEKKISILEKAFELNPDSEELLLALLKAYRSRDNADVLISRW
EKALMQNSASYKLWREFLCVVQGEFSRFKVSEVRRLYSYAIQALSSACSKRHRQVDTTSE
PLDSAAIQQELVLVDMLVSLCRFEWQAGYQELATALLQAEVEFSIFSPSLLLTEQSKLRL
FEHFWSSNGARVGEEGAFGWLLWLEKEEENRQKILKEESSDDNEVGGWTGWTEQVSGRNG
DDIASANTGEVDVDRKGLDEEMEDENSKPEDDTEAMLKLLGIDVNTAASDEVKDTSTWVK
WFEEEVSRDHSQWMPTRKAGEFSSVEGMGEGEDEEQLSSVVLYEDINGYLFSLRSKEARL
SLVYQFIDFFGAHISPWTSSNSLSWSEKISSLETFSDSMLENLRSVHECLSKSDSANCFS
LGSLLGGSCDLSMRTEMMKFLRNAILLCLNVFPRNYILEEAVLVAEELFVTNMKTCEVAT
MPCQALAKRLLKSDRQDLLLCGVYAQREAASGNMKHARRVFDMALTSICGLPKELQCNTP
LLCLWYAESEVANSSGSGRDTESSSRAMHILCYLGSGLAYSPYTSQSSSMQILRARQGFR
EKLKKIQSTWSHGVTDDQSAALVCSAALFEELTNDLPGALEILEHMFSSVLPGRKSQSHQ
LELLFNYYVRMLQRHQDDLTLSQLWKPISEGLQLYPLNPELYRALVDICNHRMTSHKLRM
MFDDYSRKNSSVVVWLFALSYELSKGGSSHRIRGLFERALAQDTQNNSVILWRCYIAYEI
DIADNPSAARRIYFRAINACPWSKKLWLDGFGKLGSVLTAKEMSDLQEVMRDKELNIRTD
IYEILLMQG

www.000webhost.com

Other information
Ka divergence:-0.807289KaKs divergence:0.0296224
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):2571Length 2 (bp):3450Length divergence:0.146
MFE 1 (kcal):-799.19MFE 2 (kcal):-1077.67MFE divergence0.148