Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G18070-AT3G18080
Species:Arabidopsis
Duplication type:TD
Function (paralog1):beta glucosidase 43
Function (paralog2):B-S glucosidase 44

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:1.9130073752728
Log2 mRNA fold difference:3.1619756578875
Log2 TE fold difference:-1.243331249008
Sequences
Protein sequence

MFLFLLLLSASRSGEESPSGDAVPLATGGLNRKSFPEGFLFGTATSAYQVEGETHQDGRG
PSIWDAFVKIPGKIANNATAEITVDQYHRYKEDVDLMQNLNIDAYRFSISWSRIFPEGSG
KINSNGVAYYNRLIDYLIEKGITPYANLYHYDLPLALEQKYQGLLSKQGRFCGLRRVLFQ
TFGDRVKNWMTFNEPRVVAALGYDNGIFAPGRCSEAFGNCTDGNSATEPYIVAHHLILAH
AAAVQRYRQNYQEKQKGRVGILLDFVWFEPLTSSQADNDAAQRARDFHVGWFIHPIVYGE
YPNTLQNIVKERLPKFTEEEVKMVKGSIDFVGINQYTTYFMSDPKISTTPKDLGYQQDWN
VTFNFAKNGTPIGPRAHSEWLYNVPWGMYKALMYIEERYGNPTMILSENGMDDPGNITLT
QGLNDTTRVKYYRDYLVQLKKAVDDGANLTGYFAWSLLDNFEWLSGYTSRFGIVYVDYKD
LKRYPKMSALWFKQLLKRDQK

MRHLSSPPWPLLLLLLLSSFTSGESSLSAEKNKLHTGGLSRQSFPKGFVFGTATSAYQVE
GETHQDGRGPSIWDAFVKIPGKIAKNATAEITVDQYHRYKEDVDLMKKLNFDAYRFSISW
SRIFPEGSGKVNWKGVAYYNRLIDYMVQKGITPYANLYHYDLPLALENKYKGLLGRQVVK
DFADYAEFCYKTFGDRVKNWMTFNEPRVVAALGYDNGIFAPGRCSKAFGNCTEGNSATEP
YIVTHHLILAHAAAVQRYRKYYQAKQKGRVGILLDFVWYEPLTRSKADNLAAQRARDFHI
GWFIHPLVYGEYPKTMQNIVKERLPKFTEKEVKMVKGSIDFVGINQYTTYYMSEPHPTTK
PKDLGYQQDWNVEFGFAKLGKPIGPRAYSSWLYNVPWGMYKALMYMKERYGNPTMILSEN
GMDDPGNVTLAQGLHDTTRIKYYKDYLTNLKKARDDGANVVGYFAWSLLDNFEWLSGYTS
RFGIVYVDYKTLKRYPKMSAQWFKQLLKRNNK

www.000webhost.com

Other information
Ka divergence:-0.190737KaKs divergence:-0.281895
GC content 1 (%):42GC content 2 (%):43GC content divergence:0.012
Length 1 (bp):1506Length 2 (bp):1539Length divergence:0.011
MFE 1 (kcal):-429.86MFE 2 (kcal):-430.78MFE divergence0.001