Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G18170-AT3G18180
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Glycosyltransferase family 61 protein
Function (paralog2):Glycosyltransferase family 61 protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-3.9962136156834
Log2 mRNA fold difference:-4.5642484071062
Log2 TE fold difference:0.57412933834192
Sequences
Protein sequence

MKPICTKLARTEFCELNGDVRVHGKSATVSAAITFAFSGNSTWHIRPYARKGDTVAMKRV
REWTVKLEQNADQLENANFSRCVRNHSVPAMIFSLGGYSMNNFHDFTDIVIPLYTTARRF
NGEVQFLVTNKSPSWINKFKELVRKLSNYEVIYIDEEDETHCFSSVTVGLTRHREYFKEL
TIDPSNSEYSMSDFRSFLRDTYSLRNDAVATRQIRRRRPRILILARGRSRAFVNTGEIAR
AARQIGFKVVVAEANIGIAKFAQTVNSCDVMLGVHGAGLTNMVFLPENAVVIQVLPIGGF
EWLAKTDFEKPSEGMNLRYLEYKIAVEESTLVKKYGRDHEIVRDPSAVAKHGWEMFKSVY
LVQQNVSIDINRFKPVLVKALELL

MTKKDILYDTVLARSFSKTDQKRLCCGAFIASLLLVLTLCTVVKPYLSPLPIVELQLSVG
TGLRMLSITELTTNTTISKEEVISECNKMEKPICHCNTLGSKEFCDVSGDVRIHGKSATV
LAAVTFAFSGNSTWYMRPYARKDQVPAMKRVREWTVKLVQNASLSRCVRNHSVPAILFSL
GGFSLNNFHDFTDIVIPLYTTARRFSGEVQFLVTNKNLLWINKFKELVRKLSNYEVIYID
EEDETHCFSSVIVGLNRHRDYDKELTTDPSNSEYSMSDFRKFLRDTYSLRNSAVTTRRKP
RILILSRSRSRAFVNAGEIARAARQIGFKVVVAEANTEIASFAITVNSCDVMLGVHGAGM
TNMVFLPDNAIVIQILPIGGFEWLAKMDFEYPSKGMNLRYLEYKITAEESTLVKQYGRDH
EFVRDPLAVAKRGWGTFKSVYLVQQNVSVDINRFKLVLVKALELLHNQSV

www.000webhost.com

Other information
Ka divergence:0.0893456KaKs divergence:-0.731794
GC content 1 (%):49GC content 2 (%):46GC content divergence:-0.032
Length 1 (bp):1155Length 2 (bp):1413Length divergence:0.1
MFE 1 (kcal):-400.99MFE 2 (kcal):-450.61MFE divergence0.058