Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G18960-AT3G18990
Species:Arabidopsis
Duplication type:TD
Function (paralog1):AP2/B3-like transcriptional factor family protein
Function (paralog2):AP2/B3-like transcriptional factor family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.69151081659702
Log2 mRNA fold difference:0.30846089826748
Log2 TE fold difference:0.34502538046152
Sequences
Protein sequence

MVTTQNTKARVTSVSHRRSQQDPESPVKKFFKLVLPSTMKDKMMKIPPRFVKLQGSKLSE
VVTLETPAGFKRSIKLKRIGEEIWFHEGWSEFAEAHSIEEGHFLLFEYKENSSFRVIIFN
VSACETKYPLDAVHIIDSDDDIIDITGKEFVGTQGTRKNNQSVNGGDTEHKSKKRSRDIE
LDKILHDLDVMNPMHVLKEEEEDKRVFRG

MPRPFFHKLIFSSTIQEKRLRVPDKFVSKFKDELSVAVALTVPDGHVWRVGLRKADNKIW
FQDGWQEFVDRYSIRIGYLLIFRYEGNSAFSVYIFNLSHSEINYHSTGLMDSAHNHFKRA
RLFEDLEDEDAEVIFPSSVYPSPLPESTVPANKGYASSAIQTLFTGPVKAEEPTPTPKIP
KKRGRKKKNADPEEINSSAPRDDDPENRSKFYESASARKRTVTAEERERAINAAKTFEPT
NPFFRVVLRPSYLYRGCIMYLPSGFAEKYLSGISGFIKVQLAEKQWPVRCLYKAGRAKFS
QGWYEFTLENNLGEGDVCVFELLRTRDFVLKVTAFRVNEYV

www.000webhost.com

Other information
Ka divergence:-0.401542KaKs divergence:0.665579
GC content 1 (%):43GC content 2 (%):45GC content divergence:0.023
Length 1 (bp):630Length 2 (bp):1026Length divergence:0.239
MFE 1 (kcal):-183MFE 2 (kcal):-287.87MFE divergence0.223