Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G19000-AT3G19010
Species:Arabidopsis
Duplication type:TD
Function (paralog1):2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein
Function (paralog2):2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.6943737346097
Log2 mRNA fold difference:1.099577690549
Log2 TE fold difference:0.3109564391552
Sequences
Protein sequence

MGELDEAFIQAPEHRPNTHLTNSGDFIFSDEIPTIDLSSLEDTHHDKTAIAKEIAEACKR
WGFFQVINHGLPSALRHRVEKTAAEFFNLTTEEKRKVKRDEVNPMGYHDEEHTKNVRDWK
EIFDFFLQDSTIVPASPEPEDTELRKLTNQWPQNPSHFREVCQEYAREVEKLAFRLLELV
SISLGLPGDRLTGFFNEQTSFLRFNHYPPCPNPELALGVGRHKDGGALTVLAQDSVGGLQ
VSRRSDGQWIPVKPISDALIINMGNCIQVWTNDEYWSAEHRVVVNTSKERFSIPFFFFPS
HEANIEPLEELISEENPPCYKKYNWGKFFVSRNRSDFKKLEVENIQIDHFKA

MEDLDPTYIQAPEHRSDSNFIPNQPEEIPVIDLSRLDDPEDVQNVISEIGDACEKWGFFQ
VLNHGVPSDARQRVEKTVKMFFDLPMEEKIKVKRDDVNPVGYHDGEHTKNVKDWKEVFDI
YFKDPMVIPSTTDPEDEGLRLVYNKWPQSPSDFREACEVYARHAEKLAFKLLELISLSLG
LPKERFHDYFKEQMSFFRINRYPPCPRPDLALGVGHHKDADVISLLAQDDVGGLQVSRRS
DGVWFPIRPVPNALVINIGNCMEIWTNDKYWSAEHRVVVNTTRERYSIPFFLLPSHDVEV
KPLEELVSPENPPKYKGYKWGKFYVSRNRSDFRKLEIENIQIDDFKVKT

www.000webhost.com

Other information
Ka divergence:0.0970633KaKs divergence:0.0305419
GC content 1 (%):44GC content 2 (%):41GC content divergence:-0.035
Length 1 (bp):1059Length 2 (bp):1050Length divergence:-0.004
MFE 1 (kcal):-306.62MFE 2 (kcal):-298.8MFE divergence-0.013