Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G19390-AT3G19400
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Granulin repeat cysteine protease family protein
Function (paralog2):Cysteine proteinases superfamily protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:1.3071736127232
Log2 mRNA fold difference:1.9871627300107
Log2 TE fold difference:-0.66112445253692
Sequences
Protein sequence

MATSIKSITLALLIFSVLLISLSLGSVTATETTRNEAEARRMYERWLVENRKNYNGLGEK
ERRFEIFKDNLKFVEEHSSIPNRTYEVGLTRFADLTNDEFRAIYLRSKMERTRVPVKGEK
YLYKVGDSLPDAIDWRAKGAVNPVKDQGSCGSCWAFSAIGAVEGINQIKTGELISLSEQE
LVDCDTSYNDGCGGGLMDYAFKFIIENGGIDTEEDYPYIATDVNVCNSDKKNTRVVTIDG
YEDVPQNDEKSLKKALANQPISVAIEAGGRAFQLYTSGVFTGTCGTSLDHGVVAVGYGSE
GGQDYWIVRNSWGSNWGESGYFKLERNIKESSGKCGVAMMASYPTKSSGSNPPKPPAPSP
VVCDKSNTCPAKSTCCCLYEYNGKCYSWGCCPYESATCCDDGSSCCPQSYPVCDLKANTC
RMKGNSPLSIKALTRGPAIATTKSTNMLVGSA

MAATPIRVIVSALVILSVLLLSSSLGVATETEIERNETEVRLMYEQWLVENRKNYNGLGE
KERRFKIFKDNLKFVDEHNSVPDRTFEVGLTRFADLTNEEFRAIYLRKKMERTKDSVKTE
RYLYKEGDVLPDEVDWRANGAVVSVKDQGNCGSCWAFSAVGAVEGINQITTGELISLSEQ
ELVDCDRGFVNAGCDGGIMNYAFEFIMKNGGIETDQDYPYNANDLGLCNADKNNNTRVVT
IDGYEDVPRDDEKSLKKAVAHQPVSVAIEASSQAFQLYKSGVMTGTCGISLDHGVVVVGY
GSTSGEDYWIIRNSWGLNWGDSGYVKLQRNIDDPFGKCGIAMMPSYPTKSSFPSSFDLLS
EI

www.000webhost.com

Other information
Ka divergence:0.258768KaKs divergence:0.504111
GC content 1 (%):44GC content 2 (%):42GC content divergence:-0.023
Length 1 (bp):1359Length 2 (bp):1089Length divergence:-0.11
MFE 1 (kcal):-430.26MFE 2 (kcal):-333.13MFE divergence-0.127