Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G21465-AT4G15640
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:1.0653692243118
Log2 mRNA fold difference:0.6186965933045
Log2 TE fold difference:0.43871772361597
Sequences
Protein sequence

MQYLSHSRRIARALKPLALVETDVRFVSNAPSHVVHRSLSHSVFPGKMDTCNQLYAQSPM
TGLMMLRANFSSEAKHVENPTEAVKELHSKILDSVNVKRSMPPNAWLWSLIDNCRNEDDI
SFLFDVLQNLRRFRLSNLRIHDNFNCNLCQQVAKTCVRVGAINHGKRALWKHNVHGLTPS
VASAHHLLSYALKHKDAKLMDEVMKLLKMNNLPLQPGTADLVFRICHDTDNWDLLVKYSK
KFCKAGVKLRKTTFDVWMEFAAKRGDTESLWNVDKLRSETYTQHTLSGAFSCAKGFLLEH
KPEEAAAVIQIICQAYPDEKKSALEAEFKKLVNEWSVDIIKHQNEQDKKDVAASLKSDIP
AMVNALVNSGLRVRVDLNELNKNEALLS

MQFLQNSRRIATVLKPIVTTETNLRFFSSASQISRSFQWRSQASSSSSVLKGIDSSSHLS
SMSLLIPRSSFTSEAEKLAGNPTVTVKDLHDKMLNSVNVKRSMPPNAWLWLLIENCQNQD
DIHLLFDVLQNLRRFRLSNLRIHDNFNCNLCQQVAKTCVRVGAIDSGKKALWKHNVHGLT
PSVASAHHLMSYALEHKNSELMEEVMQLLKTNDLPLQPGTADLVFRICHDTDKWDLLAKY
SKKFSKAGVKLRKTTFDVWMEFAAKRGDTESLWKVDKQRSETYSQHTLSTAFSCAKGFLL
ESKPEEAAAVIQIICQAYPDEKKSAISTEFEKLVNEWPVDVIKHQTDEDKKALAASLKSV
IPSMVNTLLSSGLKVSVDLDELNKNEALLS

www.000webhost.com

Other information
Ka divergence:-0.145279KaKs divergence:-0.470203
GC content 1 (%):41GC content 2 (%):41GC content divergence:0
Length 1 (bp):1167Length 2 (bp):1173Length divergence:0.003
MFE 1 (kcal):-335.2MFE 2 (kcal):-335.76MFE divergence0.001