Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G21560-AT4G15500
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):UDP-Glycosyltransferase superfamily protein
Function (paralog2):UDP-Glycosyltransferase superfamily protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-4.2777095761478
Log2 mRNA fold difference:-3.7132690126972
Log2 TE fold difference:-0.54943786547275
Sequences
Protein sequence

MELESSPPLPPHVMLVSFPGQGHVNPLLRLGKLLASKGLLITFVTTESWGKKMRISNKIQ
DRVLKPVGKGYLRYDFFDDGLPEDDEASRTNLTILRPHLELVGKREIKNLVKRYKEVTKQ
PVTCLINNPFVSWVCDVAEDLQIPCAVLWVQSCACLAAYYYYHHNLVDFPTKTEPEIDVQ
ISGMPLLKHDEIPSFIHPSSPHSALREVIIDQIKRLHKTFSIFIDTFNSLEKDIIDHMST
LSLPGVIRPLGPLYKMAKTVAYDVVKVNISEPTDPCMEWLDSQPVSSVVYISFGTVAYLK
QEQIDEIAYGVLNADVTFLWVIRQQELGFNKEKHVLPEEVKGKGKIVEWCSQEKVLSHPS
VACFVTHCGWNSTMEAVSSGVPTVCFPQWGDQVTDAVYMIDVWKTGVRLSRGEAEERLVP
REEVAERLREVTKGEKAIELKKNALKWKEEAEAAVARGGSSDRNLEKFVEKLGAKPVGKV
QNGSHNHVLAGSIKSF

MEMESSLPHVMLVSFPGQGHISPLLRLGKIIASKGLIVTFVTTEEPLGKKMRQANNIQDG
VLKPVGLGFLRFEFFEDGFVYKEDFDLLQKSLEVSGKREIKNLVKKYEKQPVRCLINNAF
VPWVCDIAEELQIPSAVLWVQSCACLAAYYYYHHQLVKFPTETEPEITVDVPFKPLTLKH
DEIPSFLHPSSPLSSIGGTILEQIKRLHKPFSVLIETFQELEKDTIDHMSQLCPQVNFNP
IGPLFTMAKTIRSDIKGDISKPDSDCIEWLDSREPSSVVYISFGTLAFLKQNQIDEIAHG
ILNSGLSCLWVLRPPLEGLAIEPHVLPLELEEKGKIVEWCQQEKVLAHPAVACFLSHCGW
NSTMEALTSGVPVICFPQWGDQVTNAVYMIDVFKTGLRLSRGASDERIVPREEVAERLLE
ATVGEKAVELRENARRWKEEAESAVAYGGTSERNFQEFVDKLVDVKTMTNINNVV

www.000webhost.com

Other information
Ka divergence:-0.062563KaKs divergence:-0.478867
GC content 1 (%):46GC content 2 (%):46GC content divergence:0
Length 1 (bp):1491Length 2 (bp):1428Length divergence:-0.022
MFE 1 (kcal):-460.01MFE 2 (kcal):-453MFE divergence-0.008