Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G21650-AT4G15415
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein phosphatase 2A regulatory B subunit family protein
Function (paralog2):Protein phosphatase 2A regulatory B subunit family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.2630180553281
Log2 mRNA fold difference:0.62882751394432
Log2 TE fold difference:0.78469617467215
Sequences
Protein sequence

MIKQIFGKLPRKPSKSLQNDSNGEGGVNNSYYASNSSTTSISKPSSTSSKSSSASGSRVA
NGTLAPNSMSSNRNTNQGKKPLGGDAVVQAGPFPSSGGVYEALPSFRDVPISEKPNLFIG
KLSMCCVVFDFSDPSKNLKEKEIKRQTLLELVDYVASVGFKFNDVSMQELTKMVAVNLFR
TFPSANHESKILEIHDMDDEEPSLEPAWPHVQVVYEILLRFVASPMTDAKLAKRYIDHSF
VLKLLDLFDSEDQREREYLKTILHRVYGKFMVHRPYIRKAINNIFYRFISETEKHNGIAE
LLEILGSIINGFALPLKEEHKLFLLRALIPLHKPKCSSVYHQQLSYCIVQFVEKDFKLAD
TVIRGLLKYWPVTNSSKEVMFLGELEEVLEATQAAEFQRCMVPLSRQIARCLNSSHFQVA
ERALFLWNNDHIRNLITQNHKVIMPIVFPALERNTRGHWNQAVQSLTINVRKVLCEIDQV
LFDECLAKFQVEEVNKTEVKAKRERTWQRLEDLATSKTVVTNEAVLVPRFVSSVNLTTSS
SESTGS

MIKQIFGKLPRKPSKSSHNDSNPNGEGGVNSYYIPNSGISSISKPSSKSSASNSNGANGT
VIAPSSTSSNRTNQVNGVYEALPSFRDVPTSEKPNLFIKKLSMCCVVFDFNDPSKNLREK
EIKRQTLLELVDYIATVSTKLSDAAMQEIAKVAVVNLFRTFPSANHESKILETLDVDDEE
PALEPAWPHLQVVYELLLRFVASPMTDAKLAKRYIDHSFVLKLLDLFDSEDQREREYLKT
ILHRIYGKFMVHRPFIRKAINNIFYRFIFETEKHNGIAELLEILGSIINGFALPLKEEHK
LFLIRALIPLHRPKCASAYHQQLSYCIVQFVEKDFKLADTVIRGLLKYWPVTNSSKEVMF
LGELEEVLEATQAAEFQRCMVPLFRQIARCLNSSHFQVAERALFLWNNDHIRNLITQNHK
VIMPIVFPAMERNTRGHWNQAVQSLTLNVRKVMAETDQILFDECLAKFQEDEANETEVVA
KREATWKLLEELAASKSVSNEAVLVPRFSSSVTLATGKTSGS

Other information
Ka divergence:0.0570658KaKs divergence:-0.08646
GC content 1 (%):40GC content 2 (%):41GC content divergence:0.012
Length 1 (bp):1641Length 2 (bp):1569Length divergence:-0.022
MFE 1 (kcal):-461.5MFE 2 (kcal):-458.7MFE divergence-0.003