Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G22180-AT4G15080
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):DHHC-type zinc finger family protein
Function (paralog2):DHHC-type zinc finger family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.5582784951446
Log2 mRNA fold difference:0.61278880685837
Log2 TE fold difference:0.93032518674073
Sequences
Protein sequence

MVRKHGWQLPAHTLQVIAITVFCLLVVAFYAFFAPFVGGRIWEYVLIGVYSPVAILVFVL
YVRCTAINPADPRIMSIFDTGVNGDGMVRGLSRNYDETGSQLQASPSVVSRSSTVAGNSS
VKGSVEDAQRVESVSRRSCYNPLAVFCYVFVVEDCRKKEGPAEEQGNSEEALFCTLCNCE
VRKFSKHCRSCDKCVDCFDHHCKWLNNCVGRKNYVTFVSLMSASLLWLIIEAAVGIAVIV
RVFVNKQTMETEIVNRLGNSFSRAPLAAVVGLCTAVAIFACFPLGELLFFHMLLIKKGIT
TYEYVVAMRAMSEAPDGASVDEEIQNVLYSPTGSATTGFSGGSSLGLPYRGVWCTPPRVF
DNQDEVIPHLDPCMVPSTVDPDAPGSEKGTKALKRPVKRNAWKLAKLDPNEAARAAARAR
ASSSVLRPIDNRHLPDNDLSSIGTVSIISSVSTDANVAASKEIRNNDLRSSLSRNSFAPS
QGSRDEYDTGSHGMSNLSSPSHVHESVTLAPLPQNPTIVGNRFTATSHHMHSTFDDKVLH
RGNDADPLFLFAPATSHLRDVRKTSVVWDPEAGRYVSAPVTTTSEVRNRLLNPSSQTAST
QNPRPILPAHDSSSGSSALRDPLPLHQAERRLTYTGDSIFYGGPLINIPTRDTPRSGRGL
VRDVQDRLASTVHRDARIRRDSTSNQLPVFAPGGLGANSQTGSNIK

MVRKHGWQLPAHKFQVVAITVFCLLSVAYYAFFAPFVGGRIWEYILLGVYSPVALIVFVL
YVRCTAINPADPGIMSKFERGASRGGDLPTAKDISRKFDETGSHLQSSPSVASRTSTLPN
SSVKGSVGDAQRVEAAKRKSCFNPLAICCGVFVYEDCRSKEETDEQQGDREEALFCTLCN
AEVRKFSKHCRSCDKCVDCFDHHCRWLNNCVGRKNYMTFISLMAVSLLWLLIEAGVGIAV
IVRVFVNKKDMETEIVNRLGNGFSRAPFATVVGLCTAVSMLALFPLGELFFFHMLLIKKG
ITTYEYVVAMRAMSEAPAGASIDEEIPNVLYSPSGSATTGFSGGSSLGLPYKGAWCTPPR
VFVDYQDEVIPHLDPRMVPSTVDPDAAETAERGNKIPKRPVKISAWKLAKLNSNEATRAA
ARARASSSVLRPIENRHLHDDELSSRSGTISVVSSVSTEANGATLSREIRNNDPMLSHCR
NSYAPSQGSRDEYDTGTHSMSSLSSPSHVHETVTLSPLPQHHTAGHRFTAAAASNSSRPP
LNQATNHMIHSTFDEKIMQKGNHADPLLLPAPAASLLRDVRRTSVVWDQEAGRYISVPAT
TSEPRTRFSSQNQPIPSSHMGNTQNPRPVGHPPQDSSSGRAPPPTQQQQGERLMYTGESI
FFGGPLVNIPNRDGLRHDGDSGREGQDRMTLTLPREARFKRDTTSNQLPVFAPVGTRK

www.000webhost.com

Other information
Ka divergence:-0.226623KaKs divergence:-0.39783
GC content 1 (%):45GC content 2 (%):45GC content divergence:0
Length 1 (bp):2121Length 2 (bp):2157Length divergence:0.008
MFE 1 (kcal):-688.73MFE 2 (kcal):-671.5MFE divergence-0.013