Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G22220-AT4G15020
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):hAT transposon superfamily
Function (paralog2):hAT transposon superfamily

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.15353554465506
Log2 mRNA fold difference:-0.1059945597174
Log2 TE fold difference:0.09977065522709
Sequences
Protein sequence

MDSDLEPVALTPQKQDSAWKHCEVYKYGDRVQMRCLYCRKMFKGGGITRVKEHLAGKKGQ
GTICDQVPDEVRLFLQQCIDGTVRRQRKRRKSSPEPLPIAYFPPCEVETQVAASSDVNNG
FKSPSSDVVVGQSTGRTKQRTYRSRKNNAFERNDLANVEVDRDMDNLIPVAISSVKNIVH
PTSKEREKTVHMAMGRFLFDIGADFDAANSVNVQPFIDAIVSGGFGVSIPTHEDLRGWIL
KSCVEEVKKEIDECKTLWKRTGCSVLVQELNSNEGPLILKFLVYCPEKVVFLKSVDASEI
LDSEDKLYELLKEVVEEIGDTNVVQVITKCEDHYAAAGKKLMDVYPSLYWVPCAAHCIDK
MLEEFGKMDWIREIIEQARTVTRIIYNHSGVLNLMRKFTFGNDIVQPVCTSSATNFTTMG
RIADLKPYLQAMVTSSEWNDCSYSKEAGGLAMTETINDEDFWKALTLANHITAPILRVLR
IVCSERKPAMGYVYAAMYRAKEAIKTNLAHREEYIVYWKIIDRWWLQQPLYAAGFYLNPK
FFYSIDEEMRSEIHLAVVDCIEKLVPDVNIQDIVIKDINSYKNAVGIFGRNLAIRARDTM
LPAEWWSTYGESCLNLSRFAIRILSQTCSSSIGSVRNLTSISQIYESKNSIERQRLNDLV
FVQYNMRLRRIGSESSGDDTVDPLSHSNMEVLEDWVSRNQVCIEGNGSSDWKSLEFIKRS
EEVAVVIDETEDLGSGFDDAEIFKGEKEASYEGGYSENLFT

MDAELEPVALTPQKQDNAWKHCEIYKYGDRLQMRCLYCRKMFKGGGITRVKEHLAGKKGQ
GTICDQVPEDVRLFLQQCIDGTVRRQRKRHKSSSEPLSVASLPPIEGDMMVVQPDVNDGF
KSPGSSDVVVQNESLLSGRTKQRTYRSKKNAFENGSASNNVDLIGRDMDNLIPVAISSVK
NIVHPSFRDRENTIHMAIGRFLFGIGADFDAVNSVNFQPMIDAIASGGFGVSAPTHDDLR
GWILKNCVEEMAKEIDECKAMWKRTGCSILVEELNSDKGFKVLNFLVYCPEKVVFLKSVD
ASEVLSSADKLFELLSELVEEVGSTNVVQVITKCDDYYVDAGKRLMLVYPSLYWVPCAAH
CIDQMLEEFGKLGWISETIEQAQAITRFVYNHSGVLNLMWKFTSGNDILLPAFSSSATNF
ATLGRIAELKSNLQAMVTSAEWNECSYSEEPSGLVMNALTDEAFWKAVALVNHLTSPLLR
ALRIVCSEKRPAMGYVYAALYRAKDAIKTHLVNREDYIIYWKIIDRWWEQQQHIPLLAAG
FFLNPKLFYNTNEEIRSELILSVLDCIERLVPDDKIQDKIIKELTSYKTAGGVFGRNLAI
RARDTMLPAEWWSTYGESCLNLSRFAIRILSQTCSSSVSCRRNQIPVEHIYQSKNSIEQK
RLSDLVFVQYNMRLRQLGPGSGDDTLDPLSHNRIDVLKEWVSGDQACVEGNGSADWKSLE
SIHRNQVAPIIDDTEDLGSGFDDIEIFKVEKEVRDEGYYTNTSEKLFT

www.000webhost.com

Other information
Ka divergence:-0.117641KaKs divergence:-0.498588
GC content 1 (%):41GC content 2 (%):41GC content divergence:0
Length 1 (bp):2286Length 2 (bp):2307Length divergence:0.005
MFE 1 (kcal):-681.32MFE 2 (kcal):-681.04MFE divergence0