Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G22230-AT4G15000
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Ribosomal L27e protein family
Function (paralog2):Ribosomal L27e protein family

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:0.97756478622973
Log2 mRNA fold difference:0.66748938450298
Log2 TE fold difference:0.30675952424419
Sequences
Protein sequence

MVKFLKQNKAVILLQGRYAGKKAVIIKSFDDGTSDRRYGHCLVAGLKKYPSKVIRKDSAK
KTAKKSRVKCFIKLVNYQHLMPTRYTLDVDLKEVATLDALKSKDKKVTALKEAKAKLEER
FKTGKNRWFFTKLRF

MVKFLKQNKAVILLQGRYAGKKAVIIKSFDDGNRDRPYGHCLVAGLKKYPSKVIRKDSAK
KTAKKSRVKCFIKLVNYQHLMPTRYTLDVDLKEVATLDALQSKDKKVAALKEAKAKLEER
FKTGKNRWFFTKLRF

Other information
Ka divergence:-0.651024KaKs divergence:-0.410765
GC content 1 (%):47GC content 2 (%):47GC content divergence:0
Length 1 (bp):408Length 2 (bp):408Length divergence:0
MFE 1 (kcal):-125.41MFE 2 (kcal):-119.8MFE divergence-0.023