Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G22270-AT4G14990
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Topoisomerase II-associated protein PAT1
Function (paralog2):Topoisomerase II-associated protein PAT1

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.75911593076344
Log2 mRNA fold difference:0.55496776042332
Log2 TE fold difference:-1.4899604918196
Sequences
Protein sequence

MERSDSRDLYNFVRASSLDKNSTLFDASQYEFFGQNLDDMELGGLDDDGVIAPVLGHADD
DEYHLFDKGEGAGLGSLSDMDDLATTFAKLNRVVTGPKHPGVIGDRGSGSFSRESSSATD
WTQDAELTSWLDEQDQEAKRWSSQPQSFAHSKPLYRTSSYPQQQPQLQHYNSEPIILPES
NFTSFPPPGNRSPQASPGNLHRAPSLPGGSQLTYSAPSPLSNSGFHLSGLSQGPHYGGNL
TRYASCGPTLGNMVQPHWVTDPGHLHGDHSGLLHNLVQQQHQQLPPRNAIMSQHLLALQQ
RQSYAQLAALQSQLYSSYPSPSRKVPFGVGEVREHKHKSSHRSRKNRGLSQQTSDAASQK
SETGLQFRSKHMTSEEIESILKMQHSNSHSNDPYVNDYYHQAKLAKKSAGSKAISHFYPA
QLKDHQPRSRNSSEQHPQVHVDALGKITLPSVRRPHALLEVDSSPGFNDGSGDHKGSGKH
LEQEPLVAARVTIEDALGVLIDIVDIDRTLQNTRPQDGGAQLKRKRQILLEGLATALQLA
DPFSKTGQKSGMTAKDDIVFLRIATLPKGRKLLTKYLQLLVPGTENARVVCMAIFRHLRF
LFGGLPSDTLAAETISNLAKAVTVCVQAMDLRALSACLAAVVCSSEQPPLRPIGSSAGDG
ASVVLISLLERAAEVVVVPRVMHGNSNDGLWRASFDEFFNLLTKYCRSKYDTIRGQNQGS
AADVLELAIKREMPAELLRASLRHTNDDQRNYLLNFGRKPSAISESASHARGGQINSESV
RG

MERSDSRDFYNFAKTSSDNNSALFDASQYEFFGQSLEEVELGGLDDDGTVRGHVDDEEYH
LFDKREGAGLGSLSDMDDLATTFAKLNRNVTGPKHLGVIGDRGSGSFSRESSTATDWTQD
NEFTSWLDQHTVEEQVQEASWSSQPQSSPNSNSLYRTSSYPQQQTQLQHYSSEPIIVPES
TFTSFPSPGKRSQQSSPSHIHRAPSLPGGSQSNFSAPNASPLSNSTFHLSGLSHGPSHYG
NNLARYASCGPTLGNMVQQPPHWVTDPGLLHGDHSALLHSLMQQQHLQQLPPRNGFTSQQ
LISLQQRQSLAHLAALQSQLYSSYPSPSHKALFGVGEVREHKHKSSHRSRKNRGGISQQT
SDLASQKSESGLQFRSKYMTSEEIESILKMQHSNSHSSDPYVNDYYHQARLAKKSSGSRT
KPQLYPSHLKDHQSRSRNSSDQQPQVHVDALGKITLPSICRPRALLEVDSPPSSGHKHLE
DEPLVAARVTIEDAFGVLIDIVDIDRTLQFNRPQDGGAQLRRKRQILLEGLATSLQLVDP
FSKTGQKTGLTTKDDIVFLRITTLPKGRKLLTKYLQLLVPGTEIARVVCMAVFRHLRFLF
GGLPSDSLAAETIANLAKAVTVCVQAMDLRALSACLAAVVCSSEQPPLRPIGSSSGDGAS
VVLVSLLERAAEVIVAVVPPRVSNHGNPNDGLWRASFDEFFSLLTKYCRSKYETIHGQNH
DNAADVLELAIKREMPAELLRASLRHTNEDQRNFLLNVGRSASPVSESTTTRASASGGQI
NSEFVRG

www.000webhost.com

Other information
Ka divergence:0.0296524KaKs divergence:-0.344852
GC content 1 (%):45GC content 2 (%):45GC content divergence:0
Length 1 (bp):2349Length 2 (bp):2364Length divergence:0.003
MFE 1 (kcal):-725.98MFE 2 (kcal):-743.81MFE divergence0.012