Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G22360-AT3G22370
Species:Arabidopsis
Duplication type:TD
Function (paralog1):alternative oxidase 1B
Function (paralog2):alternative oxidase 1A

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:2.6370857358612
Log2 mRNA fold difference:3.6029383571658
Log2 TE fold difference:-0.95117445469615
Sequences
Protein sequence

MMMSRRYGAKLMETAVTHSHLLNPRVPLVTENIRVPAMGVVRVFSKMTFEKKKTTEEKGS
SGGKADQGNKGEQLIVSYWGVKPMKITKEDGTEWKWSCFRPWETYKSDLTIDLKKHHVPS
TLPDKLAYWTVKSLRWPTDLFFQRRYGCRAMMLETVAAVPGMVGGMLVHCKSLRRFEQSG
GWIKALLEEAENERMHLMTFMEVAKPNWYERALVIAVQGIFFNAYFLGYLISPKFAHRMV
GYLEEEAIHSYTEFLKELDNGNIENVPAPAIAIDYWRLEADATLRDVVMVVRADEAHHRD
VNHYASDIHYQGRELKEAPAPIGYH

MMITRGGAKAAKSLLVAAGPRLFSTVRTVSSHEALSASHILKPGVTSAWIWTRAPTIGGM
RFASTITLGEKTPMKEEDANQKKTENESTGGDAAGGNNKGDKGIASYWGVEPNKITKEDG
SEWKWNCFRPWETYKADITIDLKKHHVPTTFLDRIAYWTVKSLRWPTDLFFQRRYGCRAM
MLETVAAVPGMVGGMLLHCKSLRRFEQSGGWIKALLEEAENERMHLMTFMEVAKPKWYER
ALVITVQGVFFNAYFLGYLISPKFAHRMVGYLEEEAIHSYTEFLKELDKGNIENVPAPAI
AIDYWRLPADATLRDVVMVVRADEAHHRDVNHFASDIHYQGRELKEAPAPIGYH

www.000webhost.com

Other information
Ka divergence:-0.486158KaKs divergence:-0.884502
GC content 1 (%):45GC content 2 (%):45GC content divergence:0
Length 1 (bp):978Length 2 (bp):1065Length divergence:0.043
MFE 1 (kcal):-301.64MFE 2 (kcal):-339.42MFE divergence0.059