Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G22425-AT4G14910
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):imidazoleglycerol-phosphate dehydratase
Function (paralog2):HISTIDINE BIOSYNTHESIS 5B

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.9100766723718
Log2 mRNA fold difference:1.1300301628951
Log2 TE fold difference:0.64976355001552
Sequences
Protein sequence

MELSSASAILSHSSSAAQLLRPKLGFIDLLPRRAMIVSSPSSSLPRFLRMESQSQLRQSI
SCSASSSSSMALGRIGEVKRVTKETNVSVKINLDGTGVADSSSGIPFLDHMLDQLASHGL
FDVHVRATGDVHIDDHHTNEDIALAIGTALLKALGERKGINRFGDFTAPLDEALIHVSLD
LSGRPYLGYNLEIPTQRVGTYDTQLVEHFFQSLVNTSGMTLHIRQLAGENSHHIIEATFK
AFARALRQATETDPRRGGTIPSSKGVLSRS

MELLSSSPAQLLRPNLSSRALLPPRTSIASSHPPPPRFLVMNSQSQHRPSISCASPPPGD
NGFPAITTASPIESARIGEVKRETKETNVSVKINLDGHGVSDSSTGIPFLDHMLDQLASH
GLFDVHVRATGDTHIDDHHTNEDVALAIGTALLKALGERKGINRFGDFTAPLDEALIHVS
LDLSGRPYLGYNLEIPTQRVGTYDTQLVEHFFQSLVNTSGMTLHIRQLAGKNSHHIIEAT
FKAFARALRQATESDPRRGGTIPRFDFDTHYTSHSSSTIYLQRFMITKSNLERSKLWLER
LYVIRKQV

www.000webhost.com

Other information
Ka divergence:0.124135KaKs divergence:-0.0692054
GC content 1 (%):44GC content 2 (%):43GC content divergence:-0.011
Length 1 (bp):813Length 2 (bp):927Length divergence:0.066
MFE 1 (kcal):-239.88MFE 2 (kcal):-253.8MFE divergence0.028