Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G22440-AT4G14900
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):FRIGIDA-like protein
Function (paralog2):FRIGIDA-like protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.3063642885049
Log2 mRNA fold difference:-1.9281419742451
Log2 TE fold difference:0.67851922871665
Sequences
Protein sequence

MGSVPDPGELTELAQPSFEEFQKQTSLMTSCTLLWQELSDHFTSLEQNLMKKSEALKQMI
ETLDNQTQTSLESLKRREVTIDHSVEIVAGKVGERARAALESLEKARDGCGDGSNDDSGD
VDDEEGLLSALKSLCLKMDARGFWNFVTARKKELENLRSKIPAALVDCVDPAMLVLEAIS
EVFPVDTRGDKVSNDYGWACVVILESLTPVIVDPVIGKSRLLVTPSVKEKAKEIAETWKK
SLEERGRIENVKTPDVHTFLQHLVTFGIVKSEDLALYRKLVVGSAWRKQMPKLAVSVGLG
DQMPDMIEELISRGQQLDAVHFTYEVGLVDKFPPVPLLKAYLRDAKKSAASIMEDSSNTG
RATHLVARKEQSALKAVLKCIEEYKLEEEFPPENLKKRLDQLEKTKTEKRKPAAVPANKR
TRASYNGPMPPAKAGRITNAYVSSFPFIRSPSHSPQYASPAAYPSPPTTVYSNRSPPYPY
SPEIIPGSYQGSPIGYPAYNGYCNGPVPAPAPPVYHPHHHQHHQFHHQQHYY

MESSPDPGELIKSSQPSFFEFQKQASLMTSCNLLWKELSEHFTSMEQNLMKKSEALRQMI
ETLDNQTQSSIELLKHREVTIDHSVEIAEGKVEERVRAALDSLEKARDCGDEDTGEVDDG
DGLLSALKSLCLKMDARGFWGFVIARKKELENLRSQIPVALVDCVDPPKLVLEAVSEVFP
VDKRGGGEKVSNDFGWACVVILESLIPVMVDPVMGKSRLLVTPSVKEKAKEIAETWKASL
EERGGIENVKTPDVHTFLQHLVTFGIVKKDDLALYRKLVVGSAWRKQMPKLAVSVGLGDQ
MPDMIEELIIRGQQLDAVHFTFEVGLVHLFPPVPLLKAYLRDAKKATALITDDSNNSGRS
AHLVARKEQSALRAVLKCIEEYKLEEEFPPENLKKRLDQLEKTKTEKRKPAVIPANKRTR
ASYSGPMPPAKAGRITNAYVSSFPPPPPTFIRSQSHSPQYGVPAYTTSPPTIYSNRSPPY
QYSPEAVHGSYQTSPVSYPTAYGTYCSPVAAPPPPVYHPHPHHHHHIQHAYY

Other information
Ka divergence:0.415693KaKs divergence:0.333866
GC content 1 (%):46GC content 2 (%):47GC content divergence:0.011
Length 1 (bp):1599Length 2 (bp):1599Length divergence:0
MFE 1 (kcal):-488.6MFE 2 (kcal):-521.8MFE divergence0.033