Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G22460-AT4G14880
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):O-acetylserine (thiol) lyase (OAS-TL) isoform A2
Function (paralog2):O-acetylserine (thiol) lyase (OAS-TL) isoform A1

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:7.9439761118952
Log2 mRNA fold difference:7.4097515992867
Log2 TE fold difference:0.4955778490511
Sequences
Protein sequence

MASVAPKIAKDVTELIGNTPLVYLNKVAKDCVGHVAAKLEMMEPCSSVKDRIGYSMIADA
EAKGLIKPGESVLIEPTSGNTGVGLAFTAAAKGYKLVITMPASMSIERRIILLAFGAELI
LTDPAKGMKGAVAKAEEILAKTPNGYMLQQFENPANPKIHYETTGPEIWKGAGKYLKEQN
TNIKLYGVEPVESPILSGGKPGPHKIQGIGAGFIPGILDVDLIDEVVQVSSEESIDMARL
LAREEGLLVGISSGAAATAAIKLAKRPENAGKLIVAVFPSFGERYLSTVLFDAARKEAET
MTFEP

MASRIAKDVTELIGNTPLVYLNNVAEGCVGRVAAKLEMMEPCSSVKDRIGFSMISDAEKK
GLIKPGESVLIEPTSGNTGVGLAFTAAAKGYKLIITMPASMSTERRIILLAFGVELVLTD
PAKGMKGAIAKAEEILAKTPNGYMLQQFENPANPKIHYETTGPEIWKGTGGKIDGFVSGI
GTGGTITGAGKYLKEQNANVKLYGVEPVESAILSGGKPGPHKIQGIGAGFIPSVLNVDLI
DEVVQVSSDESIDMARQLALKEGLLVGISSGAAAAAAIKLAQRPENAGKLFVAIFPSFGE
RYLSTVLFDATRKEAEAMTFEA

www.000webhost.com

Other information
Ka divergence:0.0868785KaKs divergence:0.355117
GC content 1 (%):43GC content 2 (%):45GC content divergence:0.023
Length 1 (bp):918Length 2 (bp):969Length divergence:0.027
MFE 1 (kcal):-274.34MFE 2 (kcal):-318.81MFE divergence0.075