Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G22520-AT4G14840
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-2.726022742871
Log2 mRNA fold difference:-1.7976048892274
Log2 TE fold difference:-0.94612077655244
Sequences
Protein sequence

MSAPIYSPIDMQEIVQNPPGFDTEPVPISTYRDNEPVPLSTYRENDSDHLDATQQENDDF
WENGFSREEAIEDPEPSQAKENGKRSVDNSAFTHGETDLNQLPAIPPVSTGQGLPYAPVD
WPSPGDVWTWRVGRRVTAMGYHQDRFLILPQRLQQKHVPKSFASKPQLARYLESDFPGMD
ADAFFASFSWKVPALFQPANKVDAASLFEETPKEVQTEVGQNDENAQDGKGNSRYSQRKR
KPMPTPQTYEPVEAKPKSTPRGSSNKKKKGATTPATGPQSSTKPKPSRQSGRRTSIQQRG
GAVDLNFLNEEESEPATAPKTSNKRKKRGVNYEEEDVSIPHIYVSPMNGVLAVSHSPIDV
NPEEFDSYLNSLDNLMQQPPEEVGRDSSVLVSVSSPMREYEWAEARMKISSLLEKDFTTL
FLSKDAAEIAALATKLRKDPNLTAEEIVRLKLMEEIPTFSEVFQENKGVIEEADRFFSAL
ELNKAKVASLKYEYSDLKEKLGSIQMEVDTNSETIRQIDDQIAQLQARRSELKRYIGTKE
KERVDLSYGQKMVANSIPKVVQEVQSANLKKPEWECKKDNALKREAEILSKFTPLKGFFL

MDMDQEIGQNSPGFDGESVVSMSNRSKETEPVPVENDYYRENGFNSDGDGDDVKVNGDRS
SFTDLNQLPAIPPASSGQGLPFAPVDFPSPGDVWTWRVGRRVNNAGFHKDRLLILPERLK
GKNVPKSFASKNTLSRYLETSFPDMDANAFFASFTWNIPALFQPAERVDAASLFEETSKE
GQNQDEDAEDVKKEGSTSRYSQRKRKQVQIQTNEPKATPRASNRKKTATTTPAAEHKSAR
ESSSKRYTRQQQGDVFDLTEENKESDAKKGSKRMKKRRGNYADEEEEEEAFVPHIYVSSM
NGVIAVSHPPVDINPEEFDSYLNSLENLLQQQPSEAGQESSSSLPVSASSPVRDYEWTEA
RMKLSSLLEKDFSSLFMSNEATEMASLAAKLKKDPSLSAEEIVRLKLIEEIPTFSEVFQE
NQSMIVEADRFFSALELNKAKVASLKYEYSDLKDKLGNIQTEVDRNSETIRQIDEQIAQL
QAKRTELTRCISNKGKEKVDLIFGQKMVANSIPKVVQEVQAANLKKPEWEMKKDNALKRE
SEILNKFAPLKGFYL

Other information
Ka divergence:-0.0126274KaKs divergence:0.0359786
GC content 1 (%):45GC content 2 (%):43GC content divergence:-0.023
Length 1 (bp):1803Length 2 (bp):1668Length divergence:-0.039
MFE 1 (kcal):-552.12MFE 2 (kcal):-481.28MFE divergence-0.069