Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G22530-AT4G14830
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.98201398721713
Log2 mRNA fold difference:-1.6730362901232
Log2 TE fold difference:0.55848888002029
Sequences
Protein sequence

MILIPVKIQSLFSYLLLLNLIQSIDKPNPEAMRVHPIPRNINNTLIHHHHHNPTREPGKN
LRRLPHIFNRVLELPLRSEADVAVEERHDCFRFVAETVGLCNGDGEMRAYMVEIHPGITK
IVVRTNGSSSLGLSLDELELDVWRFRLPESTRPELVTVACVDGDLIVTVPKNAEEEDDDG
GGGDFGQGIGSGRLVLVQ

MKIHPLPRNENNNNLIHHARDPTREPGKKLRRLPHIFSRVLELPLKSDADVAVEESHDCF
RFVAETDGGGGGGVRAYMVEIHPGVTKILVRTNGSSSLGLSLDELELDVWRFRLPESTRP
ELVTVDCDGDGELIVTVPKIEDNGRDLIVLVQ

www.000webhost.com

Other information
Ka divergence:-0.209832KaKs divergence:0.0619694
GC content 1 (%):43GC content 2 (%):49GC content divergence:0.065
Length 1 (bp):597Length 2 (bp):459Length divergence:-0.131
MFE 1 (kcal):-179.6MFE 2 (kcal):-145.1MFE divergence-0.106