Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G22630-AT4G14800
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):20S proteasome beta subunit D1
Function (paralog2):20S proteasome beta subunit D2

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-0.44143746670562
Log2 mRNA fold difference:-0.56843236675061
Log2 TE fold difference:0.14019677749857
Sequences
Protein sequence

MECVFGLVGNGFAIVAADTSAVHSILLHKNNEDKIMVLDSHKLVAASGEPGDRVQFTEYV
QKNVSLYKFRNGIPLTTAAAANFTRGELATALRKNPYSVNILMAGYDDESGASLYYIDYI
ATLHKVDKGAFGYGSYFSLSTMDRHYRSDMSVEEAIELVDKCILEIRSRLVVAPPNFVIK
IVDKDGARDYAWRQSVKDVTTAVV

MECVFGLVGNGFAIVAADTSAVHSILLHKNKEDKIMTLDSHKLVAASGEPGDRVQFTEYV
QKNVSLYQFRNGIPLSTAAAANFTRGELATALRKEFCATFQGYSDFCVLMNPYSVNILMA
GYDKEAGASLYYIDYIATLHKVDKGAFGYGSYFSLSTMDRHYRSDMSVEEAIELVDKCIL
EIRSRLVIAPPNFVIKIVDKDGAREYGWRISTADA

www.000webhost.com

Other information
Ka divergence:0.438376KaKs divergence:0.33578
GC content 1 (%):47GC content 2 (%):46GC content divergence:-0.011
Length 1 (bp):615Length 2 (bp):648Length divergence:0.026
MFE 1 (kcal):-187.5MFE 2 (kcal):-197.33MFE divergence0.026