Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G22760-AT4G14770
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Tesmin/TSO1-like CXC domain-containing protein
Function (paralog2):TESMIN/TSO1-like CXC 2

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:0.5104923923767
Log2 mRNA fold difference:0.19085440658202
Log2 TE fold difference:0.3340867953577
Sequences
Protein sequence

MDTPEKSETQIGTPVSKLKVEDSPVFSYICNLSPIKTIKPIPITCPLSSLNYASPPSVFT
SPHAVSHKESRFRSQKDVSASKEVGEEEALVGSEPEQSYKNDCNTPRVTNDVKDNGCGKD
LQVMMDNVKKKSDTPDWETLIAATTELIYGSPRESEAFSCLLKKTSNSEARLRGSITATS
VAVTNTDVVNNESESVDALSILHRGVRRRCLDFEVKGNNQQTLGESSSSCVVPSIGLHLN
TIAMSSKDKNVANEYSFSGNIKVGVQSSLTPVLHSQHDIVRENESGKDSGQIIEVVPKSL
ASVDLTPISPKKKRRKSEQSGEGDSSCKRCNCKKSKCLKLYCECFAAGFYCIEPCSCINC
FNKPIHKDVVLATRKQIESRNPLAFAPKVIRNSDSIIEVGEDASKTPASARHKRGCNCKK
SNCLKKYCECYQGGVGCSINCRCEGCKNAFGRKDGSLFEQDEENETSGTPGTKKTQQNVE
LFKPAAPPSTPIPFRQPLAQLPISSNNRLLPPQSHFHHGAIGSSSSGIYNIRKPDMSLLS
HSRIETITEDIDDMSENLIHSPITTLSPNSKRVSLSHLDSPESTPWRRNGGGRNLIRSFP
TFPSLTPHH

MDTPQKSITQIGTPISKSRFEDSPVFNYINSLSPIRPVRSIPNPNQFSSLNFTSPPSVFT
SPHLTSSHKESRFFKTHNSSSSDPTNSVESQEDESTSHEEVPAEGEDTKGLNIDDCMREE
ASVETNLDDSVASPCGGNTTDLSLVPYAPTRGEDGSCEDNGMELQKMHDNVQGKTETPDW
ESLIADASELLIFDSPDASEAFRCFMMQRASNSEARFRNGVEKQTMQHDSNKEPESANAI
PYEAVSLLHRGIRRRCLDFEMPGNKQTSSENNTAACESSSRCVVPSIGLHLNAILMSSKD
CKTNVTQDYSCSANIQVGLQRSISTLQDSLDQTENEIREDADQDVPVEPALQELNLSSPK
KKRVKLDSGEGESCKRCNCKKSKCLKLYCECFAAGVYCIEPCSCIDCFNKPIHEDVVLAT
RKQIESRNPLAFAPKVIRNSDSVQETGDDASKTPASARHKRGCNCKKSNCLKKYCECYQG
GVGCSINCRCEGCKNAFGRKDGSSIDMEAEQEEENETSEKSRTAKSQQNTEVLMRKDMSS
ALPTTPTPIYRPELVQLPFSSSKNRMPPPQSLLGGGSSSGIFNSQYLRKPDISLSQSRIE
KSFETVAVDGAEQMPEILIHSPIPNIKSVSPNGKRVSPPHMESSSSGSILGRRNGGRKLI
LQSIPSFPSLTPQH

www.000webhost.com

Other information
Ka divergence:-0.146292KaKs divergence:-0.178904
GC content 1 (%):41GC content 2 (%):43GC content divergence:0.024
Length 1 (bp):1830Length 2 (bp):2025Length divergence:0.051
MFE 1 (kcal):-501.11MFE 2 (kcal):-579.72MFE divergence0.073