Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G22790-AT4G14760
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Kinase interacting (KIP1-like) family protein
Function (paralog2):kinase interacting (KIP1-like) family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.1235211920663
Log2 mRNA fold difference:0.9838764247728
Log2 TE fold difference:0.099487838619683
Sequences
Protein sequence

MATVLHSESRRLYSWWWDSHIPKNSKWIQQNLSDMDSKVKAMIKLIEEDADSFARRAEMY
YKKRPELMKLVEEFYRAYRALAERYDHATVELCHAHKTMAEAFPNQVPFDMIEDSASSSC
SEPRTPEKMPPGIQPFYDSDSATSKRGLSQLTEYLGNSETEVESLKRTLVELGAEKEALN
LQYQLSLNKFSRLEKDLEVAQKDVSGLDERASKAEIETKILAEALAKLEAERDAALLRYN
ESMQKITELEESFSHAQEDVKGLTNRATKAETEVENLKQAHSRLHSEKEAGLAEYNRCLE
MISNLEKKVRDAEENAQNFSNQSAKAEDEIKALRHELVKVNEVKDGLRLRYQQCLETISK
LEREVSHAQDNAKRLSSEVLAGAAKLKTVEDQCTLLESSNETLKLEADGLTHKLAAKDQE
IFQKQNELEKFQSLIEDEHSRYLEIEVSLKTLQSLYSQSQEEQKVITSELQSRIGMLRDL
ETRNLKLEGDISSVKEENQNLSELNDSSMIFLETQKCEISSLKEIKEKLEEEVARHINQS
SAFQEEIRRLKDEIDSLNKRYQAIMEQVNLAGLDPKSLACSVRKLQDENSKLTELCNHQS
DDKDALTEKLRELDNILRKNVCLEKLLLESNTKLDGSREKTKDLQERCESLRGEKYEFIA
ERANLLSQLQIMTENMQKLLEKNSLLETSLSGANIELQCVKEKSKCFEEFFQLLKNDKAE
LIKERESLISQLNAVKEKLGVLEKKFTELEGKYADLQREKQFKNLQVEELRVSLATEKQE
RASYERSTDTRLADLQNNVSFLREECRSRKKEFEEELDRAVNAQVEIFILQKFIEDLEQK
NFSLLIECQKYAEASSFSEKLIAELESENLEQQMEAEFLVHEIDNFRGAICQVFKALQVE
ADCKTADQKIAKERIPVSRVLGEINELKCSLSSAEYETQRLVIENSVLLSLLGQFQSDGM
KLESEKRDVEKDLETIVHHYGMLKKDRLELLEMNRQLKSELIDREQRELELKAELQTEHL
KFENLHESYMALHQDYSDALGKNKSLHLKFSELKGEICILEEENGAILEEAIALNNVSVV
YQSLGSEKAEQAEAFAKNLNSLQNINSGLKQKVETLEEILKGKEVDSQELNSKLEKLQES
LEEANELNDLLEHQILVKEETLRQKAIELLEAEEMLKATHNANAELCEAVEELRKDCKES
RKLKGNLEKRNSELCDLAGRQDEEIKILSNLKENLESEVKLLHKEIQEHRVREEFLSSEL
QEKSNEFGLWDAEATSFYFDLQISAVREVLLENKVQELTGVCENLKDEAVTKTTEINQIK
ETVGFLEFEVSELKTQLSAYDPVVASLAEDVRSLEQNALSLMKLPVPAGRRREGVQNDEH
QEAAVSQEPVGHCSTNLDNGIVLLQDMKTRIKTIKQAVAEEKKRRGKLRRRSSSHRSKDR
KLFEEIELEDQFSGEIRQPRSPAMTESKNGSLMKDIPLDQVADTTSYGRSRRTSRGSSDQ
MLELWEEAAEPESSIKFLINNKNSKKPLIPRLHRRSRNPSVESQSEKMVGVVDKLELSRS
TEDNAKILERLLSDSRRLASLRISLRDLKSKLEINEKPGKFTNPDFARVRKQMKEMEEAI
FQLANTNEILSNEIEETGDVRDIYRKVVMEKSRIGSEKIEQMQQEMQNIERTVLKLEEGA
TKSKGRRKFSESRTVILLRDIIHKGGKRTARKKKNRFCGCMRSSGNEE

MASLSQSESGRLYSWWWDSHIPKNSKWIQDNLADMDSKVKTMIKLIEADADSFARRADMY
FKKRPELMKLVEELYRAYRALAERYDHTTVELRRAHKVMVEAFPNQMSFDMIEDSASSSS
EPRTEADTEALQKDGTKSKRSFSQMNKLDGTSDSHEADSEVETLKRTLLELQTEKEALNL
QYQLILSKVSRFEKELNDAQKDVKGFDERACKADIEIKILKESLAKLEVERDTGLLQYSQ
AIERIADLEASISHGQEYAKGLTNRVSEAEREAMSLKKELSRLQSEKEAGLLRYNKSLEL
ISSLEKTIRDAEESVRVFRDQSEQAETEIKALKQELLKLNEVNEDLNVRYQQCLETISKL
EREVSHAQDNAKRLSSEVLAGAAKIKTVEEQCALLESFNQTMKVEAENLAHKMSAKDQEL
SQKQNEIEKLQAVMQEEQLRFSELGASLRNLESLHSQSQEEQKVLTSELHSRIQMLRELE
MRNSKLEGDISSKEENRNLSEINDTSISLEIQKNEISCLKKMKEKLEEEVAKQMNQSSAL
QVEIHCVKGNIDSMNRRYQKLIDQVSLTGFDPESLSYSVKKLQDENSKLVELCTNQRDEN
NAVTGKLCEMDSILKRNADLEKLLLESNTKLDGSREKAKDLIERCESLRGEKSELAAERA
NLVSQLQIMTANMQTLLEKNSVLEKSLSCANIELESLRDKSKCFDDFFQFLKNDKSELMK
ERESLVSQLCKVEEKLGVLEKKYTELEVRYTDLQRDNKLKSHQVEELQVSLAAEKQESAN
YKRSTESRLADLQKNVSFLREECRSRKREYEDELDRVVNKQVEIFILQKLIEDLEQKNFS
LLIECQKHVEASEFSEKLIAELESENLEQQMEAEIFLDEIDSLRGAIYQVIKALQVEADC
KTEQKITKDQISVSRALGEIDSLKGSLSSAEYEMHRLVVENSVLLSLLGQFQSDGLVLES
EKNILEKDLKTKIHQCGMLEKDKQDLQEANRLLKSKLIKREQQEQKLRAELKFENLKFES
LHDSYMVLQQDYSYTLNDNKTLLLKFSEFKDGMHVVEEENDAILQEAVALSNTCVVYRSF
GSEMAEEVEDFVETVSSLREISTGLKRKVETLEKKLEGKEKESQGLNKMLENLQEGLEED
NFLTGLLEHQVSNVDEILEHREMEILEAEHMLKATNNENEELHKEVEELRKDYEDSRRMR
ANLEWQISELSDVAGRQEEEIRKLNALNENLESEVQFLNKEIQRQQVREEYLSLELQEKS
NEIGLWDSAATSFYFDLQVSAIRELILENKVNELSGVCENLNDEVVTKTTKIKQMKETVG
FLESQVTELKSQLSAYDPVIASLAGDVKALEKSTHALTKFPATAYQQRVGNNLEESGSTT
SPCNGIVILKEINPSIKTIEQAFVKEKGRLSRQITRSTSQKRRDRRKIENIQPDDQVTGE
SRQPRLRPEMTEVKNELLMKDNPRDQVTDSLTYGRSQGTSHGSNDMFEFWDESAESETSV
NFLINSNKPQRSLNSNLRHQSRNPSIESDKAVGVVDKLELSRNIEDKAKILERLLSDSRR
LSSLRISLTDLKRKLEMNEKQRRFSNADLVIVKRQLKEMEEAVSQLENTNEILSKEIEET
GDARDIYRKVVVEKSRSGSEKIEQLQNKMQNIEQTVLKLEDGTKSKGRKMFSETRTVILL
RDIIHKGGKRSARKKKNRFCGCIRSSTKEE

www.000webhost.com

Other information
Ka divergence:0.259216KaKs divergence:0.297781
GC content 1 (%):41GC content 2 (%):41GC content divergence:0
Length 1 (bp):5187Length 2 (bp):5133Length divergence:-0.005
MFE 1 (kcal):-1522.06MFE 2 (kcal):-1466.98MFE divergence-0.018